Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1339855..1340077 Replicon chromosome
Accession NZ_CP029239
Organism Escherichia coli strain BH212

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag DF195_RS06760 Protein ID WP_000170955.1
Coordinates 1339855..1339962 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1340010..1340077 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DF195_RS06730 1335711..1336544 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
DF195_RS06735 1336541..1336933 + 393 WP_000200374.1 invasion regulator SirB2 -
DF195_RS06740 1336937..1337746 + 810 WP_001257044.1 invasion regulator SirB1 -
DF195_RS06745 1337782..1338636 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DF195_RS06750 1338785..1338892 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1338940..1339006 + 67 NuclAT_33 - -
- 1338940..1339006 + 67 NuclAT_33 - -
- 1338940..1339006 + 67 NuclAT_33 - -
- 1338940..1339006 + 67 NuclAT_33 - -
- 1338940..1339006 + 67 NuclAT_35 - -
- 1338940..1339006 + 67 NuclAT_35 - -
- 1338940..1339006 + 67 NuclAT_35 - -
- 1338940..1339006 + 67 NuclAT_35 - -
- 1338940..1339006 + 67 NuclAT_37 - -
- 1338940..1339006 + 67 NuclAT_37 - -
- 1338940..1339006 + 67 NuclAT_37 - -
- 1338940..1339006 + 67 NuclAT_37 - -
- 1338940..1339006 + 67 NuclAT_39 - -
- 1338940..1339006 + 67 NuclAT_39 - -
- 1338940..1339006 + 67 NuclAT_39 - -
- 1338940..1339006 + 67 NuclAT_39 - -
- 1338940..1339006 + 67 NuclAT_41 - -
- 1338940..1339006 + 67 NuclAT_41 - -
- 1338940..1339006 + 67 NuclAT_41 - -
- 1338940..1339006 + 67 NuclAT_41 - -
- 1338940..1339006 + 67 NuclAT_43 - -
- 1338940..1339006 + 67 NuclAT_43 - -
- 1338940..1339006 + 67 NuclAT_43 - -
- 1338940..1339006 + 67 NuclAT_43 - -
- 1338942..1339007 + 66 NuclAT_17 - -
- 1338942..1339007 + 66 NuclAT_17 - -
- 1338942..1339007 + 66 NuclAT_17 - -
- 1338942..1339007 + 66 NuclAT_17 - -
- 1338942..1339007 + 66 NuclAT_20 - -
- 1338942..1339007 + 66 NuclAT_20 - -
- 1338942..1339007 + 66 NuclAT_20 - -
- 1338942..1339007 + 66 NuclAT_20 - -
- 1338942..1339007 + 66 NuclAT_23 - -
- 1338942..1339007 + 66 NuclAT_23 - -
- 1338942..1339007 + 66 NuclAT_23 - -
- 1338942..1339007 + 66 NuclAT_23 - -
- 1338942..1339007 + 66 NuclAT_26 - -
- 1338942..1339007 + 66 NuclAT_26 - -
- 1338942..1339007 + 66 NuclAT_26 - -
- 1338942..1339007 + 66 NuclAT_26 - -
- 1338942..1339007 + 66 NuclAT_29 - -
- 1338942..1339007 + 66 NuclAT_29 - -
- 1338942..1339007 + 66 NuclAT_29 - -
- 1338942..1339007 + 66 NuclAT_29 - -
- 1338942..1339007 + 66 NuclAT_32 - -
- 1338942..1339007 + 66 NuclAT_32 - -
- 1338942..1339007 + 66 NuclAT_32 - -
- 1338942..1339007 + 66 NuclAT_32 - -
DF195_RS06755 1339320..1339427 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1339475..1339542 + 68 NuclAT_16 - -
- 1339475..1339542 + 68 NuclAT_16 - -
- 1339475..1339542 + 68 NuclAT_16 - -
- 1339475..1339542 + 68 NuclAT_16 - -
- 1339475..1339542 + 68 NuclAT_19 - -
- 1339475..1339542 + 68 NuclAT_19 - -
- 1339475..1339542 + 68 NuclAT_19 - -
- 1339475..1339542 + 68 NuclAT_19 - -
- 1339475..1339542 + 68 NuclAT_22 - -
- 1339475..1339542 + 68 NuclAT_22 - -
- 1339475..1339542 + 68 NuclAT_22 - -
- 1339475..1339542 + 68 NuclAT_22 - -
- 1339475..1339542 + 68 NuclAT_25 - -
- 1339475..1339542 + 68 NuclAT_25 - -
- 1339475..1339542 + 68 NuclAT_25 - -
- 1339475..1339542 + 68 NuclAT_25 - -
- 1339475..1339542 + 68 NuclAT_28 - -
- 1339475..1339542 + 68 NuclAT_28 - -
- 1339475..1339542 + 68 NuclAT_28 - -
- 1339475..1339542 + 68 NuclAT_28 - -
- 1339475..1339542 + 68 NuclAT_31 - -
- 1339475..1339542 + 68 NuclAT_31 - -
- 1339475..1339542 + 68 NuclAT_31 - -
- 1339475..1339542 + 68 NuclAT_31 - -
- 1339476..1339541 + 66 NuclAT_34 - -
- 1339476..1339541 + 66 NuclAT_34 - -
- 1339476..1339541 + 66 NuclAT_34 - -
- 1339476..1339541 + 66 NuclAT_34 - -
- 1339476..1339541 + 66 NuclAT_36 - -
- 1339476..1339541 + 66 NuclAT_36 - -
- 1339476..1339541 + 66 NuclAT_36 - -
- 1339476..1339541 + 66 NuclAT_36 - -
- 1339476..1339541 + 66 NuclAT_38 - -
- 1339476..1339541 + 66 NuclAT_38 - -
- 1339476..1339541 + 66 NuclAT_38 - -
- 1339476..1339541 + 66 NuclAT_38 - -
- 1339476..1339541 + 66 NuclAT_40 - -
- 1339476..1339541 + 66 NuclAT_40 - -
- 1339476..1339541 + 66 NuclAT_40 - -
- 1339476..1339541 + 66 NuclAT_40 - -
- 1339476..1339541 + 66 NuclAT_42 - -
- 1339476..1339541 + 66 NuclAT_42 - -
- 1339476..1339541 + 66 NuclAT_42 - -
- 1339476..1339541 + 66 NuclAT_42 - -
- 1339476..1339541 + 66 NuclAT_44 - -
- 1339476..1339541 + 66 NuclAT_44 - -
- 1339476..1339541 + 66 NuclAT_44 - -
- 1339476..1339541 + 66 NuclAT_44 - -
DF195_RS06760 1339855..1339962 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1340010..1340077 + 68 NuclAT_15 - Antitoxin
- 1340010..1340077 + 68 NuclAT_15 - Antitoxin
- 1340010..1340077 + 68 NuclAT_15 - Antitoxin
- 1340010..1340077 + 68 NuclAT_15 - Antitoxin
- 1340010..1340077 + 68 NuclAT_18 - Antitoxin
- 1340010..1340077 + 68 NuclAT_18 - Antitoxin
- 1340010..1340077 + 68 NuclAT_18 - Antitoxin
- 1340010..1340077 + 68 NuclAT_18 - Antitoxin
- 1340010..1340077 + 68 NuclAT_21 - Antitoxin
- 1340010..1340077 + 68 NuclAT_21 - Antitoxin
- 1340010..1340077 + 68 NuclAT_21 - Antitoxin
- 1340010..1340077 + 68 NuclAT_21 - Antitoxin
- 1340010..1340077 + 68 NuclAT_24 - Antitoxin
- 1340010..1340077 + 68 NuclAT_24 - Antitoxin
- 1340010..1340077 + 68 NuclAT_24 - Antitoxin
- 1340010..1340077 + 68 NuclAT_24 - Antitoxin
- 1340010..1340077 + 68 NuclAT_27 - Antitoxin
- 1340010..1340077 + 68 NuclAT_27 - Antitoxin
- 1340010..1340077 + 68 NuclAT_27 - Antitoxin
- 1340010..1340077 + 68 NuclAT_27 - Antitoxin
- 1340010..1340077 + 68 NuclAT_30 - Antitoxin
- 1340010..1340077 + 68 NuclAT_30 - Antitoxin
- 1340010..1340077 + 68 NuclAT_30 - Antitoxin
- 1340010..1340077 + 68 NuclAT_30 - Antitoxin
DF195_RS06770 1340366..1341466 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
DF195_RS06775 1341736..1341966 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DF195_RS06780 1342124..1342819 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
DF195_RS06785 1342863..1343216 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
DF195_RS06790 1343401..1344795 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T105283 WP_000170955.1 NZ_CP029239:c1339962-1339855 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T105283 NZ_CP029239:c1339962-1339855 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT105283 NZ_CP029239:1340010-1340077 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References