Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
Location | 2290704..2290902 | Replicon | chromosome |
Accession | NZ_CP029172 | ||
Organism | Staphylococcus aureus strain PTDrAP2 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | DD562_RS11775 | Protein ID | WP_001802298.1 |
Coordinates | 2290798..2290902 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2290704..2290742 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD562_RS11755 | 2286824..2287489 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
DD562_RS11760 | 2287641..2287961 | + | 321 | WP_109028251.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
DD562_RS11765 | 2287963..2288943 | + | 981 | WP_000019735.1 | CDF family zinc efflux transporter CzrB | - |
DD562_RS11770 | 2289209..2290300 | + | 1092 | WP_000495673.1 | hypothetical protein | - |
- | 2290704..2290742 | + | 39 | - | - | Antitoxin |
DD562_RS11775 | 2290798..2290902 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
DD562_RS11790 | 2291582..2291740 | + | 159 | WP_001792784.1 | hypothetical protein | - |
DD562_RS11800 | 2292398..2293255 | - | 858 | WP_000370942.1 | Cof-type HAD-IIB family hydrolase | - |
DD562_RS11805 | 2293323..2294105 | - | 783 | WP_000908191.1 | ABC transporter ATP-binding protein | - |
DD562_RS11810 | 2294395..2295003 | - | 609 | WP_109028252.1 | TIR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T105140 WP_001802298.1 NZ_CP029172:c2290902-2290798 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T105140 NZ_CP029172:c2290902-2290798 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT105140 NZ_CP029172:2290704-2290742 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|