Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1964619..1964801 | Replicon | chromosome |
Accession | NZ_CP029166 | ||
Organism | Staphylococcus aureus strain SVH7513 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | DD555_RS10045 | Protein ID | WP_001801861.1 |
Coordinates | 1964619..1964714 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1964742..1964801 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DD555_RS09995 | 1960279..1960905 | + | 627 | WP_000669046.1 | hypothetical protein | - |
DD555_RS10000 | 1960946..1961290 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
DD555_RS10005 | 1961388..1961939 | + | 552 | WP_000414205.1 | hypothetical protein | - |
DD555_RS10010 | 1962157..1962798 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
DD555_RS10015 | 1962912..1963097 | - | 186 | WP_000809857.1 | hypothetical protein | - |
DD555_RS10020 | 1963099..1963275 | - | 177 | WP_000375476.1 | hypothetical protein | - |
DD555_RS10025 | 1963286..1963669 | - | 384 | WP_000070811.1 | hypothetical protein | - |
DD555_RS10035 | 1964273..1964416 | - | 144 | WP_001549059.1 | transposase | - |
DD555_RS10045 | 1964619..1964714 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1964742..1964801 | - | 60 | - | - | Antitoxin |
DD555_RS10050 | 1964837..1964938 | + | 102 | WP_001791893.1 | hypothetical protein | - |
DD555_RS10055 | 1964916..1965092 | - | 177 | Protein_1881 | transposase | - |
DD555_RS10060 | 1965286..1965663 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1938594..2018467 | 79873 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T105114 WP_001801861.1 NZ_CP029166:1964619-1964714 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T105114 NZ_CP029166:1964619-1964714 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT105114 NZ_CP029166:c1964801-1964742 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|