Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1087190..1087412 | Replicon | chromosome |
Accession | NZ_CP029164 | ||
Organism | Escherichia coli strain 104 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | DDV95_RS05640 | Protein ID | WP_000170738.1 |
Coordinates | 1087305..1087412 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1087190..1087256 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DDV95_RS05615 | 1082631..1083533 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
DDV95_RS05620 | 1083544..1084527 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
DDV95_RS05625 | 1084524..1085528 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
DDV95_RS05630 | 1085558..1086829 | - | 1272 | WP_001318103.1 | amino acid permease | - |
- | 1087190..1087256 | - | 67 | - | - | Antitoxin |
DDV95_RS05640 | 1087305..1087412 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
DDV95_RS05650 | 1087788..1087895 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
DDV95_RS25925 | 1088271..1088378 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
DDV95_RS25685 | 1088754..1088861 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
DDV95_RS05675 | 1088948..1090627 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
DDV95_RS05680 | 1090624..1090815 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
DDV95_RS05685 | 1090812..1092383 | - | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T105081 WP_000170738.1 NZ_CP029164:1087305-1087412 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T105081 NZ_CP029164:1087305-1087412 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATAGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT105081 NZ_CP029164:c1087256-1087190 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|