Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 26065..26329 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP029119 | ||
| Organism | Escherichia coli strain AR435 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | CSC22_RS27945 | Protein ID | WP_001387489.1 |
| Coordinates | 26177..26329 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 26065..26125 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC22_RS27905 | 22190..22453 | + | 264 | WP_032180564.1 | ash family protein | - |
| CSC22_RS27910 | 22371..22658 | + | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| CSC22_RS27920 | 23100..23405 | + | 306 | Protein_31 | transcription termination factor NusG | - |
| CSC22_RS27925 | 23419..24116 | - | 698 | Protein_32 | IS1 family transposase | - |
| CSC22_RS27935 | 24172..25329 | - | 1158 | Protein_33 | IS1380-like element ISEc9 family transposase | - |
| CSC22_RS27940 | 25515..25862 | - | 348 | Protein_34 | protein finQ | - |
| - | 26065..26125 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 26065..26125 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 26065..26125 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 26065..26125 | - | 61 | NuclAT_0 | - | Antitoxin |
| CSC22_RS27945 | 26177..26329 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| CSC22_RS27950 | 26401..26652 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| CSC22_RS27955 | 26952..27248 | + | 297 | WP_011264046.1 | hypothetical protein | - |
| CSC22_RS28730 | 27313..27489 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| CSC22_RS27960 | 27881..28090 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| CSC22_RS27965 | 28162..28824 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CSC22_RS27970 | 28895..30649 | - | 1755 | Protein_41 | DotA/TraY family protein | - |
| CSC22_RS28485 | 30648..30764 | - | 117 | Protein_42 | IncI1-type conjugal transfer lipoprotein TraH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..35284 | 35284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T104963 WP_001387489.1 NZ_CP029119:26177-26329 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T104963 NZ_CP029119:26177-26329 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT104963 NZ_CP029119:c26125-26065 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|