Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2136287..2136586 | Replicon | chromosome |
Accession | NZ_CP029087 | ||
Organism | Staphylococcus aureus strain AR461 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | CSC47_RS11210 | Protein ID | WP_011447039.1 |
Coordinates | 2136410..2136586 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2136287..2136342 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC47_RS11160 | 2131619..2131879 | + | 261 | WP_001791826.1 | hypothetical protein | - |
CSC47_RS11165 | 2131932..2132282 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
CSC47_RS11170 | 2132967..2133416 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
CSC47_RS11175 | 2133511..2133846 | - | 336 | Protein_2062 | SH3 domain-containing protein | - |
CSC47_RS11190 | 2134495..2134986 | - | 492 | WP_000919350.1 | staphylokinase | - |
CSC47_RS11195 | 2135177..2135932 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
CSC47_RS11200 | 2135944..2136198 | - | 255 | WP_000611512.1 | phage holin | - |
CSC47_RS11205 | 2136250..2136357 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2136279..2136418 | + | 140 | NuclAT_0 | - | - |
- | 2136279..2136418 | + | 140 | NuclAT_0 | - | - |
- | 2136279..2136418 | + | 140 | NuclAT_0 | - | - |
- | 2136279..2136418 | + | 140 | NuclAT_0 | - | - |
- | 2136287..2136342 | + | 56 | - | - | Antitoxin |
CSC47_RS11210 | 2136410..2136586 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
CSC47_RS11215 | 2136736..2137032 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
CSC47_RS11220 | 2137090..2137377 | - | 288 | WP_001040261.1 | hypothetical protein | - |
CSC47_RS11225 | 2137424..2137576 | - | 153 | WP_001153681.1 | hypothetical protein | - |
CSC47_RS11230 | 2137566..2141351 | - | 3786 | WP_000582154.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2131932..2185450 | 53518 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T104808 WP_011447039.1 NZ_CP029087:c2136586-2136410 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T104808 NZ_CP029087:c2136586-2136410 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT104808 NZ_CP029087:2136287-2136342 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|