Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1982073..1982253 | Replicon | chromosome |
| Accession | NZ_CP029087 | ||
| Organism | Staphylococcus aureus strain AR461 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CSC47_RS10180 | Protein ID | WP_001801861.1 |
| Coordinates | 1982073..1982168 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1982196..1982253 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CSC47_RS10150 | 1977236..1977886 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| CSC47_RS10155 | 1977967..1978962 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| CSC47_RS10160 | 1979037..1979663 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| CSC47_RS10165 | 1979704..1980045 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| CSC47_RS10170 | 1980146..1980718 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| CSC47_RS10175 | 1980916..1981928 | - | 1013 | Protein_1908 | IS3 family transposase | - |
| CSC47_RS10180 | 1982073..1982168 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1982196..1982253 | - | 58 | - | - | Antitoxin |
| CSC47_RS10185 | 1982291..1982392 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| CSC47_RS10190 | 1982370..1982531 | - | 162 | Protein_1911 | transposase | - |
| CSC47_RS10195 | 1982522..1983016 | - | 495 | Protein_1912 | transposase | - |
| CSC47_RS10200 | 1983468..1984697 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| CSC47_RS10205 | 1984690..1986246 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| CSC47_RS10210 | 1986410..1986544 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1976478..2050537 | 74059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T104804 WP_001801861.1 NZ_CP029087:1982073-1982168 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T104804 NZ_CP029087:1982073-1982168 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT104804 NZ_CP029087:c1982253-1982196 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|