Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1203720..1203904 | Replicon | chromosome |
Accession | NZ_CP029082 | ||
Organism | Staphylococcus aureus strain AR465 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | CSC50_RS06195 | Protein ID | WP_000482652.1 |
Coordinates | 1203720..1203827 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1203844..1203904 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC50_RS06170 | 1199082..1199555 | + | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
CSC50_RS06175 | 1199678..1200889 | - | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
CSC50_RS06180 | 1201071..1201730 | - | 660 | WP_000831298.1 | membrane protein | - |
CSC50_RS06185 | 1201790..1202932 | - | 1143 | WP_001176863.1 | glycerate kinase | - |
CSC50_RS06190 | 1203200..1203586 | + | 387 | WP_000779360.1 | flippase GtxA | - |
CSC50_RS06195 | 1203720..1203827 | + | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1203844..1203904 | - | 61 | - | - | Antitoxin |
CSC50_RS06205 | 1204530..1206293 | + | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
CSC50_RS06210 | 1206318..1208051 | + | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
CSC50_RS06220 | 1208282..1208449 | + | 168 | Protein_1127 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T104758 WP_000482652.1 NZ_CP029082:1203720-1203827 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T104758 NZ_CP029082:1203720-1203827 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT104758 NZ_CP029082:c1203904-1203844 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|