Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 145100..145284 | Replicon | chromosome |
Accession | NZ_CP029080 | ||
Organism | Staphylococcus aureus strain AR466 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | CSC51_RS00910 | Protein ID | WP_000482647.1 |
Coordinates | 145177..145284 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 145100..145160 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CSC51_RS00890 | 140686..140853 | - | 168 | WP_031785511.1 | hypothetical protein | - |
CSC51_RS00900 | 141084..142817 | - | 1734 | WP_000488492.1 | ABC transporter ATP-binding protein/permease | - |
CSC51_RS00905 | 142866..144605 | - | 1740 | WP_001064831.1 | ABC transporter ATP-binding protein/permease | - |
CSC51_RS14460 | 144983..145150 | - | 168 | WP_000301894.1 | hypothetical protein | - |
- | 145100..145160 | + | 61 | - | - | Antitoxin |
CSC51_RS00910 | 145177..145284 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CSC51_RS00915 | 145418..145804 | - | 387 | WP_000779354.1 | flippase GtxA | - |
CSC51_RS00920 | 146072..147214 | + | 1143 | WP_001176860.1 | glycerate kinase | - |
CSC51_RS00925 | 147274..147933 | + | 660 | WP_000831298.1 | membrane protein | - |
CSC51_RS00930 | 148113..149324 | + | 1212 | WP_001191975.1 | multidrug effflux MFS transporter | - |
CSC51_RS00935 | 149447..149920 | - | 474 | WP_000456491.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T104748 WP_000482647.1 NZ_CP029080:c145284-145177 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T104748 NZ_CP029080:c145284-145177 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT104748 NZ_CP029080:145100-145160 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|