Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 160920..161184 | Replicon | plasmid pFORC_081_1 |
Accession | NZ_CP029058 | ||
Organism | Escherichia coli strain FORC_081 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | FORC81_RS24315 | Protein ID | WP_001331364.1 |
Coordinates | 160920..161072 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 161127..161184 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC81_RS24295 | 156197..158365 | + | 2169 | WP_021537350.1 | DotA/TraY family protein | - |
FORC81_RS24300 | 158439..159089 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
FORC81_RS24305 | 159161..159370 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
FORC81_RS25825 | 159762..159938 | + | 177 | WP_001054904.1 | hypothetical protein | - |
FORC81_RS24310 | 160597..160848 | + | 252 | WP_001291964.1 | hypothetical protein | - |
FORC81_RS24315 | 160920..161072 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 161127..161184 | + | 58 | NuclAT_1 | - | Antitoxin |
- | 161127..161184 | + | 58 | NuclAT_1 | - | Antitoxin |
- | 161127..161184 | + | 58 | NuclAT_1 | - | Antitoxin |
- | 161127..161184 | + | 58 | NuclAT_1 | - | Antitoxin |
FORC81_RS24320 | 161364..162572 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
FORC81_RS24325 | 162591..163661 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
FORC81_RS24330 | 163654..165945 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / qnrS1 / tet(A) / blaTEM-1B / aac(3)-IId / floR | - | 1..253947 | 253947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T104668 WP_001331364.1 NZ_CP029058:c161072-160920 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T104668 NZ_CP029058:c161072-160920 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT104668 NZ_CP029058:161127-161184 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|