Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64911..65337 | Replicon | plasmid pFORC_081_1 |
Accession | NZ_CP029058 | ||
Organism | Escherichia coli strain FORC_081 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FORC81_RS23670 | Protein ID | WP_001312861.1 |
Coordinates | 64911..65069 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 65113..65337 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FORC81_RS23620 | 59962..60189 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
FORC81_RS23625 | 60283..60969 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
FORC81_RS23630 | 61160..61543 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
FORC81_RS23635 | 61820..62467 | + | 648 | WP_072101530.1 | transglycosylase SLT domain-containing protein | - |
FORC81_RS23645 | 62762..63583 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
FORC81_RS23650 | 63702..63989 | - | 288 | WP_000107542.1 | hypothetical protein | - |
FORC81_RS25955 | 64014..64220 | - | 207 | WP_000275853.1 | hypothetical protein | - |
FORC81_RS23670 | 64911..65069 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 65113..65337 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 65113..65337 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 65113..65337 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 65113..65337 | - | 225 | NuclAT_0 | - | Antitoxin |
FORC81_RS25815 | 65149..65337 | + | 189 | WP_001299721.1 | hypothetical protein | - |
FORC81_RS23675 | 65349..66068 | - | 720 | WP_001276235.1 | plasmid SOS inhibition protein A | - |
FORC81_RS23680 | 66065..66499 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FORC81_RS23685 | 66554..68512 | - | 1959 | WP_004023025.1 | ParB/RepB/Spo0J family partition protein | - |
FORC81_RS23690 | 68571..68804 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
FORC81_RS23695 | 68860..69387 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
FORC81_RS23715 | 69860..70120 | - | 261 | WP_112001249.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / qnrS1 / tet(A) / blaTEM-1B / aac(3)-IId / floR | - | 1..253947 | 253947 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T104664 WP_001312861.1 NZ_CP029058:c65069-64911 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T104664 NZ_CP029058:c65069-64911 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT104664 NZ_CP029058:c65337-65113 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|