Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2555430..2555614 | Replicon | chromosome |
Accession | NZ_CP029032 | ||
Organism | Staphylococcus aureus strain OXLIM |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | DDG65_RS13470 | Protein ID | WP_000482650.1 |
Coordinates | 2555507..2555614 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2555430..2555490 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DDG65_RS13445 | 2550960..2551127 | - | 168 | WP_001790576.1 | hypothetical protein | - |
DDG65_RS13455 | 2551358..2553091 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
DDG65_RS13460 | 2553116..2554879 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2555430..2555490 | + | 61 | - | - | Antitoxin |
DDG65_RS13470 | 2555507..2555614 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
DDG65_RS13475 | 2555748..2556134 | - | 387 | WP_000779358.1 | flippase GtxA | - |
DDG65_RS13480 | 2556402..2557544 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
DDG65_RS13485 | 2557604..2558263 | + | 660 | WP_000831298.1 | membrane protein | - |
DDG65_RS13490 | 2558445..2559656 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
DDG65_RS13495 | 2559779..2560252 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T104630 WP_000482650.1 NZ_CP029032:c2555614-2555507 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T104630 NZ_CP029032:c2555614-2555507 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT104630 NZ_CP029032:2555430-2555490 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|