Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2090217..2090516 | Replicon | chromosome |
Accession | NZ_CP029032 | ||
Organism | Staphylococcus aureus strain OXLIM |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | DDG65_RS10865 | Protein ID | WP_011447039.1 |
Coordinates | 2090340..2090516 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2090217..2090272 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DDG65_RS10820 | 2085548..2085808 | + | 261 | WP_001791826.1 | hypothetical protein | - |
DDG65_RS10825 | 2085861..2086211 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
DDG65_RS10830 | 2086896..2087345 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
DDG65_RS10835 | 2087440..2087775 | - | 336 | Protein_2002 | SH3 domain-containing protein | - |
DDG65_RS10845 | 2088425..2088916 | - | 492 | WP_000919350.1 | staphylokinase | - |
DDG65_RS10850 | 2089107..2089862 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
DDG65_RS10855 | 2089874..2090128 | - | 255 | WP_000611512.1 | phage holin | - |
DDG65_RS10860 | 2090180..2090287 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
- | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
- | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
- | 2090209..2090348 | + | 140 | NuclAT_0 | - | - |
- | 2090217..2090272 | + | 56 | - | - | Antitoxin |
DDG65_RS10865 | 2090340..2090516 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
DDG65_RS10870 | 2090666..2090962 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
DDG65_RS10875 | 2091020..2091307 | - | 288 | WP_001040261.1 | hypothetical protein | - |
DDG65_RS10880 | 2091354..2091506 | - | 153 | WP_001153681.1 | hypothetical protein | - |
DDG65_RS10885 | 2091496..2095281 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2085861..2144829 | 58968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T104621 WP_011447039.1 NZ_CP029032:c2090516-2090340 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T104621 NZ_CP029032:c2090516-2090340 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT104621 NZ_CP029032:2090217-2090272 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|