Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 2732..2946 | Replicon | plasmid unnamed2 |
Accession | NZ_CP028837 | ||
Organism | Enterococcus faecalis strain FC |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | C9432_RS15595 | Protein ID | WP_107164701.1 |
Coordinates | 2732..2842 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2882..2946 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9432_RS15580 | 811..2134 | + | 1324 | Protein_1 | Y-family DNA polymerase | - |
C9432_RS15585 | 2131..2481 | + | 351 | WP_010774764.1 | hypothetical protein | - |
C9432_RS15595 | 2732..2842 | + | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2882..2946 | - | 65 | - | - | Antitoxin |
C9432_RS15600 | 3083..3379 | + | 297 | WP_002369747.1 | hypothetical protein | - |
C9432_RS15605 | 3633..4415 | + | 783 | WP_002369746.1 | ParA family protein | - |
C9432_RS15610 | 4408..4764 | + | 357 | WP_002360663.1 | hypothetical protein | - |
C9432_RS15615 | 5024..6034 | + | 1011 | WP_002369743.1 | replication initiator protein A | - |
C9432_RS15620 | 6204..7361 | + | 1158 | WP_002369741.1 | TraB/GumN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | asa1 / cylR2 / cylL / cylS / cylM / cylB / cylA / cylI | 1..77890 | 77890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T104276 WP_107164701.1 NZ_CP028837:2732-2842 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T104276 NZ_CP028837:2732-2842 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT104276 NZ_CP028837:c2946-2882 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|