Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 402606..402801 | Replicon | chromosome |
Accession | NZ_CP028835 | ||
Organism | Enterococcus faecalis strain FC |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | C9432_RS02130 | Protein ID | WP_015543884.1 |
Coordinates | 402706..402801 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 402606..402671 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9432_RS02115 | 398237..399979 | + | 1743 | WP_002403026.1 | PTS transporter subunit EIIC | - |
C9432_RS02120 | 399970..402003 | + | 2034 | WP_002370205.1 | transcription antiterminator | - |
C9432_RS02125 | 402014..402448 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 402606..402671 | + | 66 | - | - | Antitoxin |
C9432_RS02130 | 402706..402801 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
C9432_RS02135 | 403047..404819 | + | 1773 | WP_010717458.1 | PTS mannitol transporter subunit IICBA | - |
C9432_RS02140 | 404834..405271 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
C9432_RS02145 | 405286..406440 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
C9432_RS02150 | 406507..407622 | - | 1116 | WP_002361174.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T104266 WP_015543884.1 NZ_CP028835:c402801-402706 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T104266 NZ_CP028835:c402801-402706 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT104266 NZ_CP028835:402606-402671 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|