104025

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2727752..2727972 Replicon chromosome
Accession NZ_CP028769
Organism Escherichia coli strain A5

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag AOY56_RS13170 Protein ID WP_000170965.1
Coordinates 2727865..2727972 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2727752..2727818 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY56_RS13145 2723031..2724425 - 1395 WP_000086213.1 inverse autotransporter invasin YchO -
AOY56_RS13150 2724610..2724963 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
AOY56_RS13155 2725007..2725702 - 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY56_RS13160 2725860..2726090 - 231 WP_053264046.1 putative cation transport regulator ChaB -
AOY56_RS13165 2726360..2727460 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2727752..2727818 - 67 - - Antitoxin
AOY56_RS13170 2727865..2727972 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2728285..2728348 - 64 NuclAT_33 - -
- 2728285..2728348 - 64 NuclAT_33 - -
- 2728285..2728348 - 64 NuclAT_33 - -
- 2728285..2728348 - 64 NuclAT_33 - -
- 2728285..2728348 - 64 NuclAT_35 - -
- 2728285..2728348 - 64 NuclAT_35 - -
- 2728285..2728348 - 64 NuclAT_35 - -
- 2728285..2728348 - 64 NuclAT_35 - -
- 2728285..2728348 - 64 NuclAT_37 - -
- 2728285..2728348 - 64 NuclAT_37 - -
- 2728285..2728348 - 64 NuclAT_37 - -
- 2728285..2728348 - 64 NuclAT_37 - -
- 2728285..2728348 - 64 NuclAT_39 - -
- 2728285..2728348 - 64 NuclAT_39 - -
- 2728285..2728348 - 64 NuclAT_39 - -
- 2728285..2728348 - 64 NuclAT_39 - -
- 2728285..2728348 - 64 NuclAT_41 - -
- 2728285..2728348 - 64 NuclAT_41 - -
- 2728285..2728348 - 64 NuclAT_41 - -
- 2728285..2728348 - 64 NuclAT_41 - -
- 2728285..2728348 - 64 NuclAT_43 - -
- 2728285..2728348 - 64 NuclAT_43 - -
- 2728285..2728348 - 64 NuclAT_43 - -
- 2728285..2728348 - 64 NuclAT_43 - -
- 2728286..2728348 - 63 NuclAT_45 - -
- 2728286..2728348 - 63 NuclAT_45 - -
- 2728286..2728348 - 63 NuclAT_45 - -
- 2728286..2728348 - 63 NuclAT_45 - -
- 2728286..2728348 - 63 NuclAT_48 - -
- 2728286..2728348 - 63 NuclAT_48 - -
- 2728286..2728348 - 63 NuclAT_48 - -
- 2728286..2728348 - 63 NuclAT_48 - -
- 2728286..2728348 - 63 NuclAT_51 - -
- 2728286..2728348 - 63 NuclAT_51 - -
- 2728286..2728348 - 63 NuclAT_51 - -
- 2728286..2728348 - 63 NuclAT_51 - -
- 2728287..2728348 - 62 NuclAT_15 - -
- 2728287..2728348 - 62 NuclAT_15 - -
- 2728287..2728348 - 62 NuclAT_15 - -
- 2728287..2728348 - 62 NuclAT_15 - -
- 2728287..2728348 - 62 NuclAT_18 - -
- 2728287..2728348 - 62 NuclAT_18 - -
- 2728287..2728348 - 62 NuclAT_18 - -
- 2728287..2728348 - 62 NuclAT_18 - -
- 2728287..2728348 - 62 NuclAT_21 - -
- 2728287..2728348 - 62 NuclAT_21 - -
- 2728287..2728348 - 62 NuclAT_21 - -
- 2728287..2728348 - 62 NuclAT_21 - -
- 2728287..2728348 - 62 NuclAT_24 - -
- 2728287..2728348 - 62 NuclAT_24 - -
- 2728287..2728348 - 62 NuclAT_24 - -
- 2728287..2728348 - 62 NuclAT_24 - -
- 2728287..2728348 - 62 NuclAT_27 - -
- 2728287..2728348 - 62 NuclAT_27 - -
- 2728287..2728348 - 62 NuclAT_27 - -
- 2728287..2728348 - 62 NuclAT_27 - -
- 2728287..2728348 - 62 NuclAT_30 - -
- 2728287..2728348 - 62 NuclAT_30 - -
- 2728287..2728348 - 62 NuclAT_30 - -
- 2728287..2728348 - 62 NuclAT_30 - -
AOY56_RS13175 2728401..2728508 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2728822..2728888 - 67 NuclAT_44 - -
- 2728822..2728888 - 67 NuclAT_44 - -
- 2728822..2728888 - 67 NuclAT_44 - -
- 2728822..2728888 - 67 NuclAT_44 - -
- 2728822..2728888 - 67 NuclAT_47 - -
- 2728822..2728888 - 67 NuclAT_47 - -
- 2728822..2728888 - 67 NuclAT_47 - -
- 2728822..2728888 - 67 NuclAT_47 - -
- 2728822..2728888 - 67 NuclAT_50 - -
- 2728822..2728888 - 67 NuclAT_50 - -
- 2728822..2728888 - 67 NuclAT_50 - -
- 2728822..2728888 - 67 NuclAT_50 - -
- 2728823..2728886 - 64 NuclAT_16 - -
- 2728823..2728886 - 64 NuclAT_16 - -
- 2728823..2728886 - 64 NuclAT_16 - -
- 2728823..2728886 - 64 NuclAT_16 - -
- 2728823..2728886 - 64 NuclAT_19 - -
- 2728823..2728886 - 64 NuclAT_19 - -
- 2728823..2728886 - 64 NuclAT_19 - -
- 2728823..2728886 - 64 NuclAT_19 - -
- 2728823..2728886 - 64 NuclAT_22 - -
- 2728823..2728886 - 64 NuclAT_22 - -
- 2728823..2728886 - 64 NuclAT_22 - -
- 2728823..2728886 - 64 NuclAT_22 - -
- 2728823..2728886 - 64 NuclAT_25 - -
- 2728823..2728886 - 64 NuclAT_25 - -
- 2728823..2728886 - 64 NuclAT_25 - -
- 2728823..2728886 - 64 NuclAT_25 - -
- 2728823..2728886 - 64 NuclAT_28 - -
- 2728823..2728886 - 64 NuclAT_28 - -
- 2728823..2728886 - 64 NuclAT_28 - -
- 2728823..2728886 - 64 NuclAT_28 - -
- 2728823..2728886 - 64 NuclAT_31 - -
- 2728823..2728886 - 64 NuclAT_31 - -
- 2728823..2728886 - 64 NuclAT_31 - -
- 2728823..2728886 - 64 NuclAT_31 - -
AOY56_RS13180 2728936..2729043 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
AOY56_RS13185 2729192..2730046 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY56_RS13190 2730082..2730891 - 810 WP_001257044.1 invasion regulator SirB1 -
AOY56_RS13195 2730895..2731287 - 393 WP_000200378.1 invasion regulator SirB2 -
AOY56_RS13200 2731284..2732117 - 834 WP_086629227.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T104025 WP_000170965.1 NZ_CP028769:2727865-2727972 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T104025 NZ_CP028769:2727865-2727972 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT104025 NZ_CP028769:c2727818-2727752 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References