Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2122396..2122616 Replicon chromosome
Accession NZ_CP028767
Organism Escherichia coli strain A7

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag AOY58_RS10010 Protein ID WP_000170965.1
Coordinates 2122396..2122503 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2122550..2122616 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY58_RS09980 2118251..2119084 + 834 WP_000456471.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY58_RS09985 2119081..2119473 + 393 WP_000200392.1 invasion regulator SirB2 -
AOY58_RS09990 2119477..2120286 + 810 WP_001257044.1 invasion regulator SirB1 -
AOY58_RS09995 2120322..2121176 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY58_RS10000 2121325..2121432 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2121480..2121546 + 67 NuclAT_43 - -
- 2121480..2121546 + 67 NuclAT_43 - -
- 2121480..2121546 + 67 NuclAT_43 - -
- 2121480..2121546 + 67 NuclAT_43 - -
- 2121480..2121546 + 67 NuclAT_46 - -
- 2121480..2121546 + 67 NuclAT_46 - -
- 2121480..2121546 + 67 NuclAT_46 - -
- 2121480..2121546 + 67 NuclAT_46 - -
- 2121480..2121546 + 67 NuclAT_49 - -
- 2121480..2121546 + 67 NuclAT_49 - -
- 2121480..2121546 + 67 NuclAT_49 - -
- 2121480..2121546 + 67 NuclAT_49 - -
- 2121482..2121545 + 64 NuclAT_15 - -
- 2121482..2121545 + 64 NuclAT_15 - -
- 2121482..2121545 + 64 NuclAT_15 - -
- 2121482..2121545 + 64 NuclAT_15 - -
- 2121482..2121545 + 64 NuclAT_18 - -
- 2121482..2121545 + 64 NuclAT_18 - -
- 2121482..2121545 + 64 NuclAT_18 - -
- 2121482..2121545 + 64 NuclAT_18 - -
- 2121482..2121545 + 64 NuclAT_21 - -
- 2121482..2121545 + 64 NuclAT_21 - -
- 2121482..2121545 + 64 NuclAT_21 - -
- 2121482..2121545 + 64 NuclAT_21 - -
- 2121482..2121545 + 64 NuclAT_24 - -
- 2121482..2121545 + 64 NuclAT_24 - -
- 2121482..2121545 + 64 NuclAT_24 - -
- 2121482..2121545 + 64 NuclAT_24 - -
- 2121482..2121545 + 64 NuclAT_27 - -
- 2121482..2121545 + 64 NuclAT_27 - -
- 2121482..2121545 + 64 NuclAT_27 - -
- 2121482..2121545 + 64 NuclAT_27 - -
- 2121482..2121545 + 64 NuclAT_30 - -
- 2121482..2121545 + 64 NuclAT_30 - -
- 2121482..2121545 + 64 NuclAT_30 - -
- 2121482..2121545 + 64 NuclAT_30 - -
AOY58_RS10005 2121860..2121967 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2122020..2122081 + 62 NuclAT_14 - -
- 2122020..2122081 + 62 NuclAT_14 - -
- 2122020..2122081 + 62 NuclAT_14 - -
- 2122020..2122081 + 62 NuclAT_14 - -
- 2122020..2122081 + 62 NuclAT_17 - -
- 2122020..2122081 + 62 NuclAT_17 - -
- 2122020..2122081 + 62 NuclAT_17 - -
- 2122020..2122081 + 62 NuclAT_17 - -
- 2122020..2122081 + 62 NuclAT_20 - -
- 2122020..2122081 + 62 NuclAT_20 - -
- 2122020..2122081 + 62 NuclAT_20 - -
- 2122020..2122081 + 62 NuclAT_20 - -
- 2122020..2122081 + 62 NuclAT_23 - -
- 2122020..2122081 + 62 NuclAT_23 - -
- 2122020..2122081 + 62 NuclAT_23 - -
- 2122020..2122081 + 62 NuclAT_23 - -
- 2122020..2122081 + 62 NuclAT_26 - -
- 2122020..2122081 + 62 NuclAT_26 - -
- 2122020..2122081 + 62 NuclAT_26 - -
- 2122020..2122081 + 62 NuclAT_26 - -
- 2122020..2122081 + 62 NuclAT_29 - -
- 2122020..2122081 + 62 NuclAT_29 - -
- 2122020..2122081 + 62 NuclAT_29 - -
- 2122020..2122081 + 62 NuclAT_29 - -
- 2122020..2122082 + 63 NuclAT_44 - -
- 2122020..2122082 + 63 NuclAT_44 - -
- 2122020..2122082 + 63 NuclAT_44 - -
- 2122020..2122082 + 63 NuclAT_44 - -
- 2122020..2122082 + 63 NuclAT_47 - -
- 2122020..2122082 + 63 NuclAT_47 - -
- 2122020..2122082 + 63 NuclAT_47 - -
- 2122020..2122082 + 63 NuclAT_47 - -
- 2122020..2122082 + 63 NuclAT_50 - -
- 2122020..2122082 + 63 NuclAT_50 - -
- 2122020..2122082 + 63 NuclAT_50 - -
- 2122020..2122082 + 63 NuclAT_50 - -
- 2122020..2122083 + 64 NuclAT_32 - -
- 2122020..2122083 + 64 NuclAT_32 - -
- 2122020..2122083 + 64 NuclAT_32 - -
- 2122020..2122083 + 64 NuclAT_32 - -
- 2122020..2122083 + 64 NuclAT_34 - -
- 2122020..2122083 + 64 NuclAT_34 - -
- 2122020..2122083 + 64 NuclAT_34 - -
- 2122020..2122083 + 64 NuclAT_34 - -
- 2122020..2122083 + 64 NuclAT_36 - -
- 2122020..2122083 + 64 NuclAT_36 - -
- 2122020..2122083 + 64 NuclAT_36 - -
- 2122020..2122083 + 64 NuclAT_36 - -
- 2122020..2122083 + 64 NuclAT_38 - -
- 2122020..2122083 + 64 NuclAT_38 - -
- 2122020..2122083 + 64 NuclAT_38 - -
- 2122020..2122083 + 64 NuclAT_38 - -
- 2122020..2122083 + 64 NuclAT_40 - -
- 2122020..2122083 + 64 NuclAT_40 - -
- 2122020..2122083 + 64 NuclAT_40 - -
- 2122020..2122083 + 64 NuclAT_40 - -
- 2122020..2122083 + 64 NuclAT_42 - -
- 2122020..2122083 + 64 NuclAT_42 - -
- 2122020..2122083 + 64 NuclAT_42 - -
- 2122020..2122083 + 64 NuclAT_42 - -
AOY58_RS10010 2122396..2122503 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2122550..2122616 + 67 - - Antitoxin
AOY58_RS10015 2122908..2124008 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AOY58_RS10020 2124278..2124508 + 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY58_RS10025 2124666..2125361 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY58_RS10030 2125405..2125758 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
AOY58_RS10035 2125943..2127337 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T103967 WP_000170965.1 NZ_CP028767:c2122503-2122396 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T103967 NZ_CP028767:c2122503-2122396 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT103967 NZ_CP028767:2122550-2122616 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References