Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 2019157..2019381 Replicon chromosome
Accession NZ_CP028761
Organism Escherichia coli strain A13

Toxin (Protein)


Gene name ldrD Uniprot ID A0A366YNB7
Locus tag AOY66_RS09700 Protein ID WP_001441942.1
Coordinates 2019157..2019264 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2019320..2019381 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY66_RS09675 (2015001) 2015001..2016083 + 1083 WP_201478328.1 peptide chain release factor 1 -
AOY66_RS09680 (2016083) 2016083..2016916 + 834 WP_000456476.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY66_RS09685 (2016913) 2016913..2017305 + 393 WP_000200375.1 invasion regulator SirB2 -
AOY66_RS09690 (2017309) 2017309..2018118 + 810 WP_001257054.1 invasion regulator SirB1 -
AOY66_RS09695 (2018154) 2018154..2019008 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY66_RS09700 (2019157) 2019157..2019264 - 108 WP_001441942.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2019320) 2019320..2019381 + 62 NuclAT_12 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_12 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_12 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_12 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_13 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_13 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_13 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_13 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_14 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_14 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_14 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_14 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_15 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_15 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_15 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_15 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_16 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_16 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_16 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_16 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_17 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_17 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_17 - Antitoxin
- (2019320) 2019320..2019381 + 62 NuclAT_17 - Antitoxin
- (2019320) 2019320..2019382 + 63 NuclAT_10 - -
- (2019320) 2019320..2019382 + 63 NuclAT_10 - -
- (2019320) 2019320..2019382 + 63 NuclAT_10 - -
- (2019320) 2019320..2019382 + 63 NuclAT_10 - -
- (2019320) 2019320..2019382 + 63 NuclAT_5 - -
- (2019320) 2019320..2019382 + 63 NuclAT_5 - -
- (2019320) 2019320..2019382 + 63 NuclAT_5 - -
- (2019320) 2019320..2019382 + 63 NuclAT_5 - -
- (2019320) 2019320..2019382 + 63 NuclAT_6 - -
- (2019320) 2019320..2019382 + 63 NuclAT_6 - -
- (2019320) 2019320..2019382 + 63 NuclAT_6 - -
- (2019320) 2019320..2019382 + 63 NuclAT_6 - -
- (2019320) 2019320..2019382 + 63 NuclAT_7 - -
- (2019320) 2019320..2019382 + 63 NuclAT_7 - -
- (2019320) 2019320..2019382 + 63 NuclAT_7 - -
- (2019320) 2019320..2019382 + 63 NuclAT_7 - -
- (2019320) 2019320..2019382 + 63 NuclAT_8 - -
- (2019320) 2019320..2019382 + 63 NuclAT_8 - -
- (2019320) 2019320..2019382 + 63 NuclAT_8 - -
- (2019320) 2019320..2019382 + 63 NuclAT_8 - -
- (2019320) 2019320..2019382 + 63 NuclAT_9 - -
- (2019320) 2019320..2019382 + 63 NuclAT_9 - -
- (2019320) 2019320..2019382 + 63 NuclAT_9 - -
- (2019320) 2019320..2019382 + 63 NuclAT_9 - -
AOY66_RS09705 (2019674) 2019674..2020774 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
AOY66_RS09710 (2021044) 2021044..2021274 + 231 WP_001146435.1 putative cation transport regulator ChaB -
AOY66_RS09715 (2021432) 2021432..2022127 + 696 WP_024176023.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY66_RS09720 (2022171) 2022171..2022524 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AOY66_RS09725 (2022709) 2022709..2024103 + 1395 WP_000085918.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3951.74 Da        Isoelectric Point: 11.4779

>T103816 WP_001441942.1 NZ_CP028761:c2019264-2019157 [Escherichia coli]
MTLAQFAVIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T103816 NZ_CP028761:c2019264-2019157 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCGTGATTTTCTGGCACGACCTAGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT103816 NZ_CP028761:2019320-2019381 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A366YNB7

Antitoxin

Download structure file

References