Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2189980..2190201 Replicon chromosome
Accession NZ_CP028758
Organism Escherichia coli strain A16

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag AOY69_RS10255 Protein ID WP_000170954.1
Coordinates 2189980..2190087 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2190140..2190201 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY69_RS10230 (2185825) 2185825..2186907 + 1083 WP_000804726.1 peptide chain release factor 1 -
AOY69_RS10235 (2186907) 2186907..2187740 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY69_RS10240 (2187737) 2187737..2188129 + 393 WP_000200378.1 invasion regulator SirB2 -
AOY69_RS10245 (2188133) 2188133..2188942 + 810 WP_001257044.1 invasion regulator SirB1 -
AOY69_RS10250 (2188978) 2188978..2189832 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY69_RS10255 (2189980) 2189980..2190087 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2190140) 2190140..2190201 + 62 NuclAT_17 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_17 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_17 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_17 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_19 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_19 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_19 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_19 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_21 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_21 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_21 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_21 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_23 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_23 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_23 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_23 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_28 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_28 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_28 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_28 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_30 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_30 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_30 - Antitoxin
- (2190140) 2190140..2190201 + 62 NuclAT_30 - Antitoxin
- (2190140) 2190140..2190203 + 64 NuclAT_32 - -
- (2190140) 2190140..2190203 + 64 NuclAT_32 - -
- (2190140) 2190140..2190203 + 64 NuclAT_32 - -
- (2190140) 2190140..2190203 + 64 NuclAT_32 - -
- (2190140) 2190140..2190203 + 64 NuclAT_34 - -
- (2190140) 2190140..2190203 + 64 NuclAT_34 - -
- (2190140) 2190140..2190203 + 64 NuclAT_34 - -
- (2190140) 2190140..2190203 + 64 NuclAT_34 - -
- (2190140) 2190140..2190203 + 64 NuclAT_36 - -
- (2190140) 2190140..2190203 + 64 NuclAT_36 - -
- (2190140) 2190140..2190203 + 64 NuclAT_36 - -
- (2190140) 2190140..2190203 + 64 NuclAT_36 - -
- (2190140) 2190140..2190203 + 64 NuclAT_38 - -
- (2190140) 2190140..2190203 + 64 NuclAT_38 - -
- (2190140) 2190140..2190203 + 64 NuclAT_38 - -
- (2190140) 2190140..2190203 + 64 NuclAT_38 - -
- (2190140) 2190140..2190203 + 64 NuclAT_40 - -
- (2190140) 2190140..2190203 + 64 NuclAT_40 - -
- (2190140) 2190140..2190203 + 64 NuclAT_40 - -
- (2190140) 2190140..2190203 + 64 NuclAT_40 - -
- (2190140) 2190140..2190203 + 64 NuclAT_42 - -
- (2190140) 2190140..2190203 + 64 NuclAT_42 - -
- (2190140) 2190140..2190203 + 64 NuclAT_42 - -
- (2190140) 2190140..2190203 + 64 NuclAT_42 - -
AOY69_RS10260 (2190516) 2190516..2190623 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2190671) 2190671..2190736 + 66 NuclAT_16 - -
- (2190671) 2190671..2190736 + 66 NuclAT_16 - -
- (2190671) 2190671..2190736 + 66 NuclAT_16 - -
- (2190671) 2190671..2190736 + 66 NuclAT_16 - -
- (2190671) 2190671..2190736 + 66 NuclAT_18 - -
- (2190671) 2190671..2190736 + 66 NuclAT_18 - -
- (2190671) 2190671..2190736 + 66 NuclAT_18 - -
- (2190671) 2190671..2190736 + 66 NuclAT_18 - -
- (2190671) 2190671..2190736 + 66 NuclAT_20 - -
- (2190671) 2190671..2190736 + 66 NuclAT_20 - -
- (2190671) 2190671..2190736 + 66 NuclAT_20 - -
- (2190671) 2190671..2190736 + 66 NuclAT_20 - -
- (2190671) 2190671..2190736 + 66 NuclAT_22 - -
- (2190671) 2190671..2190736 + 66 NuclAT_22 - -
- (2190671) 2190671..2190736 + 66 NuclAT_22 - -
- (2190671) 2190671..2190736 + 66 NuclAT_22 - -
- (2190671) 2190671..2190736 + 66 NuclAT_27 - -
- (2190671) 2190671..2190736 + 66 NuclAT_27 - -
- (2190671) 2190671..2190736 + 66 NuclAT_27 - -
- (2190671) 2190671..2190736 + 66 NuclAT_27 - -
- (2190671) 2190671..2190736 + 66 NuclAT_29 - -
- (2190671) 2190671..2190736 + 66 NuclAT_29 - -
- (2190671) 2190671..2190736 + 66 NuclAT_29 - -
- (2190671) 2190671..2190736 + 66 NuclAT_29 - -
- (2190671) 2190671..2190738 + 68 NuclAT_31 - -
- (2190671) 2190671..2190738 + 68 NuclAT_31 - -
- (2190671) 2190671..2190738 + 68 NuclAT_31 - -
- (2190671) 2190671..2190738 + 68 NuclAT_31 - -
- (2190671) 2190671..2190738 + 68 NuclAT_33 - -
- (2190671) 2190671..2190738 + 68 NuclAT_33 - -
- (2190671) 2190671..2190738 + 68 NuclAT_33 - -
- (2190671) 2190671..2190738 + 68 NuclAT_33 - -
- (2190671) 2190671..2190738 + 68 NuclAT_35 - -
- (2190671) 2190671..2190738 + 68 NuclAT_35 - -
- (2190671) 2190671..2190738 + 68 NuclAT_35 - -
- (2190671) 2190671..2190738 + 68 NuclAT_35 - -
- (2190671) 2190671..2190738 + 68 NuclAT_37 - -
- (2190671) 2190671..2190738 + 68 NuclAT_37 - -
- (2190671) 2190671..2190738 + 68 NuclAT_37 - -
- (2190671) 2190671..2190738 + 68 NuclAT_37 - -
- (2190671) 2190671..2190738 + 68 NuclAT_39 - -
- (2190671) 2190671..2190738 + 68 NuclAT_39 - -
- (2190671) 2190671..2190738 + 68 NuclAT_39 - -
- (2190671) 2190671..2190738 + 68 NuclAT_39 - -
- (2190671) 2190671..2190738 + 68 NuclAT_41 - -
- (2190671) 2190671..2190738 + 68 NuclAT_41 - -
- (2190671) 2190671..2190738 + 68 NuclAT_41 - -
- (2190671) 2190671..2190738 + 68 NuclAT_41 - -
AOY69_RS10265 (2191028) 2191028..2192128 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
AOY69_RS10270 (2192398) 2192398..2192628 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AOY69_RS10275 (2192786) 2192786..2193481 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY69_RS10280 (2193525) 2193525..2193878 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T103738 WP_000170954.1 NZ_CP028758:c2190087-2189980 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T103738 NZ_CP028758:c2190087-2189980 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT103738 NZ_CP028758:2190140-2190201 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References