Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2775975..2776195 Replicon chromosome
Accession NZ_CP028756
Organism Escherichia coli strain A19

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag AOY72_RS13430 Protein ID WP_000170965.1
Coordinates 2776088..2776195 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2775975..2776041 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY72_RS13405 2771254..2772648 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
AOY72_RS13410 2772833..2773186 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
AOY72_RS13415 2773230..2773925 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY72_RS13420 2774083..2774313 - 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY72_RS13425 2774583..2775683 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2775975..2776041 - 67 - - Antitoxin
AOY72_RS13430 2776088..2776195 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2776508..2776571 - 64 NuclAT_33 - -
- 2776508..2776571 - 64 NuclAT_33 - -
- 2776508..2776571 - 64 NuclAT_33 - -
- 2776508..2776571 - 64 NuclAT_33 - -
- 2776508..2776571 - 64 NuclAT_35 - -
- 2776508..2776571 - 64 NuclAT_35 - -
- 2776508..2776571 - 64 NuclAT_35 - -
- 2776508..2776571 - 64 NuclAT_35 - -
- 2776508..2776571 - 64 NuclAT_37 - -
- 2776508..2776571 - 64 NuclAT_37 - -
- 2776508..2776571 - 64 NuclAT_37 - -
- 2776508..2776571 - 64 NuclAT_37 - -
- 2776508..2776571 - 64 NuclAT_39 - -
- 2776508..2776571 - 64 NuclAT_39 - -
- 2776508..2776571 - 64 NuclAT_39 - -
- 2776508..2776571 - 64 NuclAT_39 - -
- 2776508..2776571 - 64 NuclAT_41 - -
- 2776508..2776571 - 64 NuclAT_41 - -
- 2776508..2776571 - 64 NuclAT_41 - -
- 2776508..2776571 - 64 NuclAT_41 - -
- 2776508..2776571 - 64 NuclAT_43 - -
- 2776508..2776571 - 64 NuclAT_43 - -
- 2776508..2776571 - 64 NuclAT_43 - -
- 2776508..2776571 - 64 NuclAT_43 - -
- 2776509..2776571 - 63 NuclAT_45 - -
- 2776509..2776571 - 63 NuclAT_45 - -
- 2776509..2776571 - 63 NuclAT_45 - -
- 2776509..2776571 - 63 NuclAT_45 - -
- 2776509..2776571 - 63 NuclAT_48 - -
- 2776509..2776571 - 63 NuclAT_48 - -
- 2776509..2776571 - 63 NuclAT_48 - -
- 2776509..2776571 - 63 NuclAT_48 - -
- 2776509..2776571 - 63 NuclAT_51 - -
- 2776509..2776571 - 63 NuclAT_51 - -
- 2776509..2776571 - 63 NuclAT_51 - -
- 2776509..2776571 - 63 NuclAT_51 - -
- 2776510..2776571 - 62 NuclAT_15 - -
- 2776510..2776571 - 62 NuclAT_15 - -
- 2776510..2776571 - 62 NuclAT_15 - -
- 2776510..2776571 - 62 NuclAT_15 - -
- 2776510..2776571 - 62 NuclAT_18 - -
- 2776510..2776571 - 62 NuclAT_18 - -
- 2776510..2776571 - 62 NuclAT_18 - -
- 2776510..2776571 - 62 NuclAT_18 - -
- 2776510..2776571 - 62 NuclAT_21 - -
- 2776510..2776571 - 62 NuclAT_21 - -
- 2776510..2776571 - 62 NuclAT_21 - -
- 2776510..2776571 - 62 NuclAT_21 - -
- 2776510..2776571 - 62 NuclAT_24 - -
- 2776510..2776571 - 62 NuclAT_24 - -
- 2776510..2776571 - 62 NuclAT_24 - -
- 2776510..2776571 - 62 NuclAT_24 - -
- 2776510..2776571 - 62 NuclAT_27 - -
- 2776510..2776571 - 62 NuclAT_27 - -
- 2776510..2776571 - 62 NuclAT_27 - -
- 2776510..2776571 - 62 NuclAT_27 - -
- 2776510..2776571 - 62 NuclAT_30 - -
- 2776510..2776571 - 62 NuclAT_30 - -
- 2776510..2776571 - 62 NuclAT_30 - -
- 2776510..2776571 - 62 NuclAT_30 - -
AOY72_RS13435 2776624..2776731 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2777045..2777111 - 67 NuclAT_44 - -
- 2777045..2777111 - 67 NuclAT_44 - -
- 2777045..2777111 - 67 NuclAT_44 - -
- 2777045..2777111 - 67 NuclAT_44 - -
- 2777045..2777111 - 67 NuclAT_47 - -
- 2777045..2777111 - 67 NuclAT_47 - -
- 2777045..2777111 - 67 NuclAT_47 - -
- 2777045..2777111 - 67 NuclAT_47 - -
- 2777045..2777111 - 67 NuclAT_50 - -
- 2777045..2777111 - 67 NuclAT_50 - -
- 2777045..2777111 - 67 NuclAT_50 - -
- 2777045..2777111 - 67 NuclAT_50 - -
- 2777046..2777109 - 64 NuclAT_16 - -
- 2777046..2777109 - 64 NuclAT_16 - -
- 2777046..2777109 - 64 NuclAT_16 - -
- 2777046..2777109 - 64 NuclAT_16 - -
- 2777046..2777109 - 64 NuclAT_19 - -
- 2777046..2777109 - 64 NuclAT_19 - -
- 2777046..2777109 - 64 NuclAT_19 - -
- 2777046..2777109 - 64 NuclAT_19 - -
- 2777046..2777109 - 64 NuclAT_22 - -
- 2777046..2777109 - 64 NuclAT_22 - -
- 2777046..2777109 - 64 NuclAT_22 - -
- 2777046..2777109 - 64 NuclAT_22 - -
- 2777046..2777109 - 64 NuclAT_25 - -
- 2777046..2777109 - 64 NuclAT_25 - -
- 2777046..2777109 - 64 NuclAT_25 - -
- 2777046..2777109 - 64 NuclAT_25 - -
- 2777046..2777109 - 64 NuclAT_28 - -
- 2777046..2777109 - 64 NuclAT_28 - -
- 2777046..2777109 - 64 NuclAT_28 - -
- 2777046..2777109 - 64 NuclAT_28 - -
- 2777046..2777109 - 64 NuclAT_31 - -
- 2777046..2777109 - 64 NuclAT_31 - -
- 2777046..2777109 - 64 NuclAT_31 - -
- 2777046..2777109 - 64 NuclAT_31 - -
AOY72_RS13440 2777159..2777266 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
AOY72_RS13445 2777415..2778269 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY72_RS13450 2778305..2779114 - 810 WP_001257044.1 invasion regulator SirB1 -
AOY72_RS13455 2779118..2779510 - 393 WP_000200378.1 invasion regulator SirB2 -
AOY72_RS13460 2779507..2780340 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T103699 WP_000170965.1 NZ_CP028756:2776088-2776195 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T103699 NZ_CP028756:2776088-2776195 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT103699 NZ_CP028756:c2776041-2775975 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References