Detailed information of TA system TA103636

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-symR/Ldr(toxin)
• Location: 2025590..2025811
• Replicon: chromosome
• Accession: NZ_CP028754
• Organism: Escherichia coli strain A21

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: AOY74_RS09625
• Protein ID: WP_000170963.1
• Coordinates: 2025590..2025697 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	symR
Locus tag	-
Coordinates	2025745..2025811 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AOY74_RS09600 (2021434)	2021434..2022516	+	1083	WP_000804726.1	peptide chain release factor 1	-
AOY74_RS09605 (2022516)	2022516..2023349	+	834	WP_022296435.1	peptide chain release factor N(5)-glutamine methyltransferase	-
AOY74_RS09610 (2023346)	2023346..2023738	+	393	WP_201482012.1	invasion regulator SirB2	-
AOY74_RS09615 (2023742)	2023742..2024551	+	810	WP_001257054.1	invasion regulator SirB1	-
AOY74_RS09620 (2024587)	2024587..2025441	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
AOY74_RS09625 (2025590)	2025590..2025697	-	108	WP_000170963.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (2025747)	2025747..2025810	+	64	NuclAT_15	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_15	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_15	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_15	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_16	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_16	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_16	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_16	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_17	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_17	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_17	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_17	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_18	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_18	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_18	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_18	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_19	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_19	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_19	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_19	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_20	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_20	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_20	-	-
- (2025747)	2025747..2025810	+	64	NuclAT_20	-	-
- (2025745)	2025745..2025811	+	67	NuclAT_10	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_10	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_10	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_10	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_11	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_11	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_11	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_11	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_12	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_12	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_12	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_12	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_7	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_7	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_7	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_7	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_8	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_8	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_8	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_8	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_9	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_9	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_9	-	Antitoxin
- (2025745)	2025745..2025811	+	67	NuclAT_9	-	Antitoxin
- (2025747)	2025747..2025812	+	66	NuclAT_21	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_21	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_21	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_21	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_22	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_22	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_22	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_22	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_23	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_23	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_23	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_23	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_24	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_24	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_24	-	-
- (2025747)	2025747..2025812	+	66	NuclAT_24	-	-
AOY74_RS09630 (2026102)	2026102..2027202	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
AOY74_RS09635 (2027472)	2027472..2027702	+	231	WP_001607244.1	putative cation transport regulator ChaB	-
AOY74_RS09640 (2027860)	2027860..2028555	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
AOY74_RS09645 (2028599)	2028599..2028952	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
AOY74_RS09650 (2029137)	2029137..2030531	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T103636 WP_000170963.1 NZ_CP028754:c2025697-2025590 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T103636 NZ_CP028754:c2025697-2025590 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT103636 NZ_CP028754:2025745-2025811 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Antitoxin