Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2012278..2012499 Replicon chromosome
Accession NZ_CP028750
Organism Escherichia coli strain A25

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AOY78_RS09830 Protein ID WP_000170963.1
Coordinates 2012278..2012385 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2012433..2012499 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY78_RS09805 (2008122) 2008122..2009204 + 1083 WP_000804719.1 peptide chain release factor 1 -
AOY78_RS09810 (2009204) 2009204..2010037 + 834 WP_021580703.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY78_RS09815 (2010034) 2010034..2010426 + 393 WP_021580704.1 invasion regulator SirB2 -
AOY78_RS09820 (2010430) 2010430..2011239 + 810 WP_001257054.1 invasion regulator SirB1 -
AOY78_RS09825 (2011275) 2011275..2012129 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY78_RS09830 (2012278) 2012278..2012385 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2012435) 2012435..2012498 + 64 NuclAT_12 - -
- (2012435) 2012435..2012498 + 64 NuclAT_12 - -
- (2012435) 2012435..2012498 + 64 NuclAT_12 - -
- (2012435) 2012435..2012498 + 64 NuclAT_12 - -
- (2012435) 2012435..2012498 + 64 NuclAT_13 - -
- (2012435) 2012435..2012498 + 64 NuclAT_13 - -
- (2012435) 2012435..2012498 + 64 NuclAT_13 - -
- (2012435) 2012435..2012498 + 64 NuclAT_13 - -
- (2012435) 2012435..2012498 + 64 NuclAT_14 - -
- (2012435) 2012435..2012498 + 64 NuclAT_14 - -
- (2012435) 2012435..2012498 + 64 NuclAT_14 - -
- (2012435) 2012435..2012498 + 64 NuclAT_14 - -
- (2012435) 2012435..2012498 + 64 NuclAT_15 - -
- (2012435) 2012435..2012498 + 64 NuclAT_15 - -
- (2012435) 2012435..2012498 + 64 NuclAT_15 - -
- (2012435) 2012435..2012498 + 64 NuclAT_15 - -
- (2012435) 2012435..2012498 + 64 NuclAT_16 - -
- (2012435) 2012435..2012498 + 64 NuclAT_16 - -
- (2012435) 2012435..2012498 + 64 NuclAT_16 - -
- (2012435) 2012435..2012498 + 64 NuclAT_16 - -
- (2012435) 2012435..2012498 + 64 NuclAT_17 - -
- (2012435) 2012435..2012498 + 64 NuclAT_17 - -
- (2012435) 2012435..2012498 + 64 NuclAT_17 - -
- (2012435) 2012435..2012498 + 64 NuclAT_17 - -
- (2012433) 2012433..2012499 + 67 NuclAT_10 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_10 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_10 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_10 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_11 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_11 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_11 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_11 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_6 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_6 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_6 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_6 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_7 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_7 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_7 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_7 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_8 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_8 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_8 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_8 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_9 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_9 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_9 - Antitoxin
- (2012433) 2012433..2012499 + 67 NuclAT_9 - Antitoxin
- (2012435) 2012435..2012500 + 66 NuclAT_20 - -
- (2012435) 2012435..2012500 + 66 NuclAT_20 - -
- (2012435) 2012435..2012500 + 66 NuclAT_20 - -
- (2012435) 2012435..2012500 + 66 NuclAT_20 - -
- (2012435) 2012435..2012500 + 66 NuclAT_21 - -
- (2012435) 2012435..2012500 + 66 NuclAT_21 - -
- (2012435) 2012435..2012500 + 66 NuclAT_21 - -
- (2012435) 2012435..2012500 + 66 NuclAT_21 - -
- (2012435) 2012435..2012500 + 66 NuclAT_22 - -
- (2012435) 2012435..2012500 + 66 NuclAT_22 - -
- (2012435) 2012435..2012500 + 66 NuclAT_22 - -
- (2012435) 2012435..2012500 + 66 NuclAT_22 - -
- (2012435) 2012435..2012500 + 66 NuclAT_23 - -
- (2012435) 2012435..2012500 + 66 NuclAT_23 - -
- (2012435) 2012435..2012500 + 66 NuclAT_23 - -
- (2012435) 2012435..2012500 + 66 NuclAT_23 - -
- (2012435) 2012435..2012500 + 66 NuclAT_26 - -
- (2012435) 2012435..2012500 + 66 NuclAT_26 - -
- (2012435) 2012435..2012500 + 66 NuclAT_26 - -
- (2012435) 2012435..2012500 + 66 NuclAT_26 - -
AOY78_RS09835 (2012790) 2012790..2013890 - 1101 WP_024242600.1 sodium-potassium/proton antiporter ChaA -
AOY78_RS09840 (2014160) 2014160..2014315 + 156 Protein_1904 ChaB family protein -
AOY78_RS09845 (2014442) 2014442..2015137 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY78_RS09850 (2015181) 2015181..2015534 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AOY78_RS09855 (2015719) 2015719..2017113 + 1395 WP_201488370.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T103533 WP_000170963.1 NZ_CP028750:c2012385-2012278 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T103533 NZ_CP028750:c2012385-2012278 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT103533 NZ_CP028750:2012433-2012499 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References