Detailed information of TA system TA103390

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2129062..2129282
• Replicon: chromosome
• Accession: NZ_CP028744
• Organism: Escherichia coli strain A31

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: AOY84_RS10135
• Protein ID: WP_000170965.1
• Coordinates: 2129062..2129169 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2129216..2129282 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AOY84_RS10105	2124917..2125750	+	834	WP_000456467.1	peptide chain release factor N(5)-glutamine methyltransferase	-
AOY84_RS10110	2125747..2126139	+	393	WP_000200378.1	invasion regulator SirB2	-
AOY84_RS10115	2126143..2126952	+	810	WP_001257044.1	invasion regulator SirB1	-
AOY84_RS10120	2126988..2127842	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
AOY84_RS10125	2127991..2128098	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2128148..2128211	+	64	NuclAT_18	-	-
-	2128148..2128211	+	64	NuclAT_18	-	-
-	2128148..2128211	+	64	NuclAT_18	-	-
-	2128148..2128211	+	64	NuclAT_18	-	-
-	2128148..2128211	+	64	NuclAT_21	-	-
-	2128148..2128211	+	64	NuclAT_21	-	-
-	2128148..2128211	+	64	NuclAT_21	-	-
-	2128148..2128211	+	64	NuclAT_21	-	-
-	2128148..2128211	+	64	NuclAT_24	-	-
-	2128148..2128211	+	64	NuclAT_24	-	-
-	2128148..2128211	+	64	NuclAT_24	-	-
-	2128148..2128211	+	64	NuclAT_24	-	-
-	2128148..2128211	+	64	NuclAT_27	-	-
-	2128148..2128211	+	64	NuclAT_27	-	-
-	2128148..2128211	+	64	NuclAT_27	-	-
-	2128148..2128211	+	64	NuclAT_27	-	-
-	2128148..2128211	+	64	NuclAT_33	-	-
-	2128148..2128211	+	64	NuclAT_33	-	-
-	2128148..2128211	+	64	NuclAT_33	-	-
-	2128148..2128211	+	64	NuclAT_33	-	-
-	2128148..2128211	+	64	NuclAT_36	-	-
-	2128148..2128211	+	64	NuclAT_36	-	-
-	2128148..2128211	+	64	NuclAT_36	-	-
-	2128148..2128211	+	64	NuclAT_36	-	-
AOY84_RS10130	2128526..2128633	-	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2128686..2128747	+	62	NuclAT_17	-	-
-	2128686..2128747	+	62	NuclAT_17	-	-
-	2128686..2128747	+	62	NuclAT_17	-	-
-	2128686..2128747	+	62	NuclAT_17	-	-
-	2128686..2128747	+	62	NuclAT_20	-	-
-	2128686..2128747	+	62	NuclAT_20	-	-
-	2128686..2128747	+	62	NuclAT_20	-	-
-	2128686..2128747	+	62	NuclAT_20	-	-
-	2128686..2128747	+	62	NuclAT_23	-	-
-	2128686..2128747	+	62	NuclAT_23	-	-
-	2128686..2128747	+	62	NuclAT_23	-	-
-	2128686..2128747	+	62	NuclAT_23	-	-
-	2128686..2128747	+	62	NuclAT_26	-	-
-	2128686..2128747	+	62	NuclAT_26	-	-
-	2128686..2128747	+	62	NuclAT_26	-	-
-	2128686..2128747	+	62	NuclAT_26	-	-
-	2128686..2128747	+	62	NuclAT_32	-	-
-	2128686..2128747	+	62	NuclAT_32	-	-
-	2128686..2128747	+	62	NuclAT_32	-	-
-	2128686..2128747	+	62	NuclAT_32	-	-
-	2128686..2128747	+	62	NuclAT_35	-	-
-	2128686..2128747	+	62	NuclAT_35	-	-
-	2128686..2128747	+	62	NuclAT_35	-	-
-	2128686..2128747	+	62	NuclAT_35	-	-
-	2128686..2128749	+	64	NuclAT_38	-	-
-	2128686..2128749	+	64	NuclAT_38	-	-
-	2128686..2128749	+	64	NuclAT_38	-	-
-	2128686..2128749	+	64	NuclAT_38	-	-
-	2128686..2128749	+	64	NuclAT_40	-	-
-	2128686..2128749	+	64	NuclAT_40	-	-
-	2128686..2128749	+	64	NuclAT_40	-	-
-	2128686..2128749	+	64	NuclAT_40	-	-
-	2128686..2128749	+	64	NuclAT_42	-	-
-	2128686..2128749	+	64	NuclAT_42	-	-
-	2128686..2128749	+	64	NuclAT_42	-	-
-	2128686..2128749	+	64	NuclAT_42	-	-
-	2128686..2128749	+	64	NuclAT_44	-	-
-	2128686..2128749	+	64	NuclAT_44	-	-
-	2128686..2128749	+	64	NuclAT_44	-	-
-	2128686..2128749	+	64	NuclAT_44	-	-
-	2128686..2128749	+	64	NuclAT_46	-	-
-	2128686..2128749	+	64	NuclAT_46	-	-
-	2128686..2128749	+	64	NuclAT_46	-	-
-	2128686..2128749	+	64	NuclAT_46	-	-
-	2128686..2128749	+	64	NuclAT_48	-	-
-	2128686..2128749	+	64	NuclAT_48	-	-
-	2128686..2128749	+	64	NuclAT_48	-	-
-	2128686..2128749	+	64	NuclAT_48	-	-
AOY84_RS10135	2129062..2129169	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2129216..2129282	+	67	-	-	Antitoxin
AOY84_RS10140	2129574..2130674	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
AOY84_RS10145	2130944..2131174	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
AOY84_RS10150	2131332..2132027	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
AOY84_RS10155	2132071..2132424	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
AOY84_RS10160	2132609..2134003	+	1395	WP_000086212.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T103390 WP_000170965.1 NZ_CP028744:c2129169-2129062 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T103390 NZ_CP028744:c2129169-2129062 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT103390 NZ_CP028744:2129216-2129282 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin