Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2127991..2128211 | Replicon | chromosome |
Accession | NZ_CP028744 | ||
Organism | Escherichia coli strain A31 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | AOY84_RS10125 | Protein ID | WP_000170954.1 |
Coordinates | 2127991..2128098 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2128148..2128211 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AOY84_RS10100 (2123835) | 2123835..2124917 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
AOY84_RS10105 (2124917) | 2124917..2125750 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
AOY84_RS10110 (2125747) | 2125747..2126139 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
AOY84_RS10115 (2126143) | 2126143..2126952 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
AOY84_RS10120 (2126988) | 2126988..2127842 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
AOY84_RS10125 (2127991) | 2127991..2128098 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_18 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_18 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_18 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_18 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_21 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_21 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_21 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_21 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_24 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_24 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_24 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_24 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_27 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_27 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_27 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_27 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_33 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_33 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_33 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_33 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_36 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_36 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_36 | - | Antitoxin |
- (2128148) | 2128148..2128211 | + | 64 | NuclAT_36 | - | Antitoxin |
AOY84_RS10130 (2128526) | 2128526..2128633 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_17 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_17 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_17 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_17 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_20 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_20 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_20 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_20 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_23 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_23 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_23 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_23 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_26 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_26 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_26 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_26 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_32 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_32 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_32 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_32 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_35 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_35 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_35 | - | - |
- (2128686) | 2128686..2128747 | + | 62 | NuclAT_35 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_38 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_38 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_38 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_38 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_40 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_40 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_40 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_40 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_42 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_42 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_42 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_42 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_44 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_44 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_44 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_44 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_46 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_46 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_46 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_46 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_48 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_48 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_48 | - | - |
- (2128686) | 2128686..2128749 | + | 64 | NuclAT_48 | - | - |
AOY84_RS10135 (2129062) | 2129062..2129169 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_16 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_16 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_16 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_16 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_19 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_19 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_19 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_19 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_22 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_22 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_22 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_22 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_25 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_25 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_25 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_25 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_31 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_31 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_31 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_31 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_34 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_34 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_34 | - | - |
- (2129217) | 2129217..2129282 | + | 66 | NuclAT_34 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_37 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_37 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_37 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_37 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_39 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_39 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_39 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_39 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_41 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_41 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_41 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_41 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_43 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_43 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_43 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_43 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_45 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_45 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_45 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_45 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_47 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_47 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_47 | - | - |
- (2129217) | 2129217..2129284 | + | 68 | NuclAT_47 | - | - |
AOY84_RS10140 (2129574) | 2129574..2130674 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
AOY84_RS10145 (2130944) | 2130944..2131174 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
AOY84_RS10150 (2131332) | 2131332..2132027 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
AOY84_RS10155 (2132071) | 2132071..2132424 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T103382 WP_000170954.1 NZ_CP028744:c2128098-2127991 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T103382 NZ_CP028744:c2128098-2127991 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT103382 NZ_CP028744:2128148-2128211 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|