Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2127991..2128211 Replicon chromosome
Accession NZ_CP028744
Organism Escherichia coli strain A31

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag AOY84_RS10125 Protein ID WP_000170954.1
Coordinates 2127991..2128098 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2128148..2128211 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY84_RS10100 (2123835) 2123835..2124917 + 1083 WP_000804726.1 peptide chain release factor 1 -
AOY84_RS10105 (2124917) 2124917..2125750 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY84_RS10110 (2125747) 2125747..2126139 + 393 WP_000200378.1 invasion regulator SirB2 -
AOY84_RS10115 (2126143) 2126143..2126952 + 810 WP_001257044.1 invasion regulator SirB1 -
AOY84_RS10120 (2126988) 2126988..2127842 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY84_RS10125 (2127991) 2127991..2128098 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2128148) 2128148..2128211 + 64 NuclAT_18 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_18 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_18 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_18 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_21 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_21 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_21 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_21 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_24 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_24 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_24 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_24 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_27 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_27 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_27 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_27 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_33 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_33 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_33 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_33 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_36 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_36 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_36 - Antitoxin
- (2128148) 2128148..2128211 + 64 NuclAT_36 - Antitoxin
AOY84_RS10130 (2128526) 2128526..2128633 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2128686) 2128686..2128747 + 62 NuclAT_17 - -
- (2128686) 2128686..2128747 + 62 NuclAT_17 - -
- (2128686) 2128686..2128747 + 62 NuclAT_17 - -
- (2128686) 2128686..2128747 + 62 NuclAT_17 - -
- (2128686) 2128686..2128747 + 62 NuclAT_20 - -
- (2128686) 2128686..2128747 + 62 NuclAT_20 - -
- (2128686) 2128686..2128747 + 62 NuclAT_20 - -
- (2128686) 2128686..2128747 + 62 NuclAT_20 - -
- (2128686) 2128686..2128747 + 62 NuclAT_23 - -
- (2128686) 2128686..2128747 + 62 NuclAT_23 - -
- (2128686) 2128686..2128747 + 62 NuclAT_23 - -
- (2128686) 2128686..2128747 + 62 NuclAT_23 - -
- (2128686) 2128686..2128747 + 62 NuclAT_26 - -
- (2128686) 2128686..2128747 + 62 NuclAT_26 - -
- (2128686) 2128686..2128747 + 62 NuclAT_26 - -
- (2128686) 2128686..2128747 + 62 NuclAT_26 - -
- (2128686) 2128686..2128747 + 62 NuclAT_32 - -
- (2128686) 2128686..2128747 + 62 NuclAT_32 - -
- (2128686) 2128686..2128747 + 62 NuclAT_32 - -
- (2128686) 2128686..2128747 + 62 NuclAT_32 - -
- (2128686) 2128686..2128747 + 62 NuclAT_35 - -
- (2128686) 2128686..2128747 + 62 NuclAT_35 - -
- (2128686) 2128686..2128747 + 62 NuclAT_35 - -
- (2128686) 2128686..2128747 + 62 NuclAT_35 - -
- (2128686) 2128686..2128749 + 64 NuclAT_38 - -
- (2128686) 2128686..2128749 + 64 NuclAT_38 - -
- (2128686) 2128686..2128749 + 64 NuclAT_38 - -
- (2128686) 2128686..2128749 + 64 NuclAT_38 - -
- (2128686) 2128686..2128749 + 64 NuclAT_40 - -
- (2128686) 2128686..2128749 + 64 NuclAT_40 - -
- (2128686) 2128686..2128749 + 64 NuclAT_40 - -
- (2128686) 2128686..2128749 + 64 NuclAT_40 - -
- (2128686) 2128686..2128749 + 64 NuclAT_42 - -
- (2128686) 2128686..2128749 + 64 NuclAT_42 - -
- (2128686) 2128686..2128749 + 64 NuclAT_42 - -
- (2128686) 2128686..2128749 + 64 NuclAT_42 - -
- (2128686) 2128686..2128749 + 64 NuclAT_44 - -
- (2128686) 2128686..2128749 + 64 NuclAT_44 - -
- (2128686) 2128686..2128749 + 64 NuclAT_44 - -
- (2128686) 2128686..2128749 + 64 NuclAT_44 - -
- (2128686) 2128686..2128749 + 64 NuclAT_46 - -
- (2128686) 2128686..2128749 + 64 NuclAT_46 - -
- (2128686) 2128686..2128749 + 64 NuclAT_46 - -
- (2128686) 2128686..2128749 + 64 NuclAT_46 - -
- (2128686) 2128686..2128749 + 64 NuclAT_48 - -
- (2128686) 2128686..2128749 + 64 NuclAT_48 - -
- (2128686) 2128686..2128749 + 64 NuclAT_48 - -
- (2128686) 2128686..2128749 + 64 NuclAT_48 - -
AOY84_RS10135 (2129062) 2129062..2129169 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2129217) 2129217..2129282 + 66 NuclAT_16 - -
- (2129217) 2129217..2129282 + 66 NuclAT_16 - -
- (2129217) 2129217..2129282 + 66 NuclAT_16 - -
- (2129217) 2129217..2129282 + 66 NuclAT_16 - -
- (2129217) 2129217..2129282 + 66 NuclAT_19 - -
- (2129217) 2129217..2129282 + 66 NuclAT_19 - -
- (2129217) 2129217..2129282 + 66 NuclAT_19 - -
- (2129217) 2129217..2129282 + 66 NuclAT_19 - -
- (2129217) 2129217..2129282 + 66 NuclAT_22 - -
- (2129217) 2129217..2129282 + 66 NuclAT_22 - -
- (2129217) 2129217..2129282 + 66 NuclAT_22 - -
- (2129217) 2129217..2129282 + 66 NuclAT_22 - -
- (2129217) 2129217..2129282 + 66 NuclAT_25 - -
- (2129217) 2129217..2129282 + 66 NuclAT_25 - -
- (2129217) 2129217..2129282 + 66 NuclAT_25 - -
- (2129217) 2129217..2129282 + 66 NuclAT_25 - -
- (2129217) 2129217..2129282 + 66 NuclAT_31 - -
- (2129217) 2129217..2129282 + 66 NuclAT_31 - -
- (2129217) 2129217..2129282 + 66 NuclAT_31 - -
- (2129217) 2129217..2129282 + 66 NuclAT_31 - -
- (2129217) 2129217..2129282 + 66 NuclAT_34 - -
- (2129217) 2129217..2129282 + 66 NuclAT_34 - -
- (2129217) 2129217..2129282 + 66 NuclAT_34 - -
- (2129217) 2129217..2129282 + 66 NuclAT_34 - -
- (2129217) 2129217..2129284 + 68 NuclAT_37 - -
- (2129217) 2129217..2129284 + 68 NuclAT_37 - -
- (2129217) 2129217..2129284 + 68 NuclAT_37 - -
- (2129217) 2129217..2129284 + 68 NuclAT_37 - -
- (2129217) 2129217..2129284 + 68 NuclAT_39 - -
- (2129217) 2129217..2129284 + 68 NuclAT_39 - -
- (2129217) 2129217..2129284 + 68 NuclAT_39 - -
- (2129217) 2129217..2129284 + 68 NuclAT_39 - -
- (2129217) 2129217..2129284 + 68 NuclAT_41 - -
- (2129217) 2129217..2129284 + 68 NuclAT_41 - -
- (2129217) 2129217..2129284 + 68 NuclAT_41 - -
- (2129217) 2129217..2129284 + 68 NuclAT_41 - -
- (2129217) 2129217..2129284 + 68 NuclAT_43 - -
- (2129217) 2129217..2129284 + 68 NuclAT_43 - -
- (2129217) 2129217..2129284 + 68 NuclAT_43 - -
- (2129217) 2129217..2129284 + 68 NuclAT_43 - -
- (2129217) 2129217..2129284 + 68 NuclAT_45 - -
- (2129217) 2129217..2129284 + 68 NuclAT_45 - -
- (2129217) 2129217..2129284 + 68 NuclAT_45 - -
- (2129217) 2129217..2129284 + 68 NuclAT_45 - -
- (2129217) 2129217..2129284 + 68 NuclAT_47 - -
- (2129217) 2129217..2129284 + 68 NuclAT_47 - -
- (2129217) 2129217..2129284 + 68 NuclAT_47 - -
- (2129217) 2129217..2129284 + 68 NuclAT_47 - -
AOY84_RS10140 (2129574) 2129574..2130674 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AOY84_RS10145 (2130944) 2130944..2131174 + 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY84_RS10150 (2131332) 2131332..2132027 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY84_RS10155 (2132071) 2132071..2132424 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T103382 WP_000170954.1 NZ_CP028744:c2128098-2127991 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T103382 NZ_CP028744:c2128098-2127991 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT103382 NZ_CP028744:2128148-2128211 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References