Detailed information of TA system TA103287

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2091094..2091314
• Replicon: chromosome
• Accession: NZ_CP028740
• Organism: Escherichia coli strain A35

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: AOY88_RS10280
• Protein ID: WP_000170965.1
• Coordinates: 2091094..2091201 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2091248..2091314 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AOY88_RS10250	2086403..2087485	+	1083	WP_000804726.1	peptide chain release factor 1	-
AOY88_RS10255	2087485..2088318	+	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-
AOY88_RS10260	2088315..2088707	+	393	WP_000200392.1	invasion regulator SirB2	-
AOY88_RS10265	2088711..2089520	+	810	WP_001257044.1	invasion regulator SirB1	-
AOY88_RS10270	2089556..2090410	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
AOY88_RS10275	2090559..2090666	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2090716..2090779	+	64	NuclAT_16	-	-
-	2090716..2090779	+	64	NuclAT_16	-	-
-	2090716..2090779	+	64	NuclAT_16	-	-
-	2090716..2090779	+	64	NuclAT_16	-	-
-	2090716..2090779	+	64	NuclAT_18	-	-
-	2090716..2090779	+	64	NuclAT_18	-	-
-	2090716..2090779	+	64	NuclAT_18	-	-
-	2090716..2090779	+	64	NuclAT_18	-	-
-	2090716..2090779	+	64	NuclAT_20	-	-
-	2090716..2090779	+	64	NuclAT_20	-	-
-	2090716..2090779	+	64	NuclAT_20	-	-
-	2090716..2090779	+	64	NuclAT_20	-	-
-	2090716..2090779	+	64	NuclAT_22	-	-
-	2090716..2090779	+	64	NuclAT_22	-	-
-	2090716..2090779	+	64	NuclAT_22	-	-
-	2090716..2090779	+	64	NuclAT_22	-	-
-	2090716..2090779	+	64	NuclAT_27	-	-
-	2090716..2090779	+	64	NuclAT_27	-	-
-	2090716..2090779	+	64	NuclAT_27	-	-
-	2090716..2090779	+	64	NuclAT_27	-	-
-	2090716..2090779	+	64	NuclAT_29	-	-
-	2090716..2090779	+	64	NuclAT_29	-	-
-	2090716..2090779	+	64	NuclAT_29	-	-
-	2090716..2090779	+	64	NuclAT_29	-	-
AOY88_RS10280	2091094..2091201	-	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2091248..2091314	+	67	-	-	Antitoxin
AOY88_RS10285	2091606..2092706	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
AOY88_RS10290	2092976..2093206	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
AOY88_RS10295	2093364..2094059	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
AOY88_RS10300	2094103..2094456	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
AOY88_RS10305	2094641..2096035	+	1395	WP_033554468.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T103287 WP_000170965.1 NZ_CP028740:c2091201-2091094 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T103287 NZ_CP028740:c2091201-2091094 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT103287 NZ_CP028740:2091248-2091314 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin