Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2091094..2091314 | Replicon | chromosome |
| Accession | NZ_CP028740 | ||
| Organism | Escherichia coli strain A35 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | AOY88_RS10280 | Protein ID | WP_000170965.1 |
| Coordinates | 2091094..2091201 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2091248..2091314 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOY88_RS10250 | 2086403..2087485 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| AOY88_RS10255 | 2087485..2088318 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| AOY88_RS10260 | 2088315..2088707 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| AOY88_RS10265 | 2088711..2089520 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| AOY88_RS10270 | 2089556..2090410 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AOY88_RS10275 | 2090559..2090666 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2090716..2090779 | + | 64 | NuclAT_16 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_16 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_16 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_16 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_18 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_18 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_18 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_18 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_20 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_20 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_20 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_20 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_22 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_22 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_22 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_22 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_27 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_27 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_27 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_27 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_29 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_29 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_29 | - | - |
| - | 2090716..2090779 | + | 64 | NuclAT_29 | - | - |
| AOY88_RS10280 | 2091094..2091201 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2091248..2091314 | + | 67 | - | - | Antitoxin |
| AOY88_RS10285 | 2091606..2092706 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| AOY88_RS10290 | 2092976..2093206 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| AOY88_RS10295 | 2093364..2094059 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AOY88_RS10300 | 2094103..2094456 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| AOY88_RS10305 | 2094641..2096035 | + | 1395 | WP_033554468.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T103287 WP_000170965.1 NZ_CP028740:c2091201-2091094 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T103287 NZ_CP028740:c2091201-2091094 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT103287 NZ_CP028740:2091248-2091314 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|