Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2090559..2090779 Replicon chromosome
Accession NZ_CP028740
Organism Escherichia coli strain A35

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag AOY88_RS10275 Protein ID WP_000170954.1
Coordinates 2090559..2090666 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2090716..2090779 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY88_RS10250 (2086403) 2086403..2087485 + 1083 WP_000804726.1 peptide chain release factor 1 -
AOY88_RS10255 (2087485) 2087485..2088318 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
AOY88_RS10260 (2088315) 2088315..2088707 + 393 WP_000200392.1 invasion regulator SirB2 -
AOY88_RS10265 (2088711) 2088711..2089520 + 810 WP_001257044.1 invasion regulator SirB1 -
AOY88_RS10270 (2089556) 2089556..2090410 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY88_RS10275 (2090559) 2090559..2090666 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2090716) 2090716..2090779 + 64 NuclAT_16 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_16 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_16 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_16 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_18 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_18 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_18 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_18 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_20 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_20 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_20 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_20 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_22 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_22 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_22 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_22 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_27 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_27 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_27 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_27 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_29 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_29 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_29 - Antitoxin
- (2090716) 2090716..2090779 + 64 NuclAT_29 - Antitoxin
AOY88_RS10280 (2091094) 2091094..2091201 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2091249) 2091249..2091314 + 66 NuclAT_15 - -
- (2091249) 2091249..2091314 + 66 NuclAT_15 - -
- (2091249) 2091249..2091314 + 66 NuclAT_15 - -
- (2091249) 2091249..2091314 + 66 NuclAT_15 - -
- (2091249) 2091249..2091314 + 66 NuclAT_17 - -
- (2091249) 2091249..2091314 + 66 NuclAT_17 - -
- (2091249) 2091249..2091314 + 66 NuclAT_17 - -
- (2091249) 2091249..2091314 + 66 NuclAT_17 - -
- (2091249) 2091249..2091314 + 66 NuclAT_19 - -
- (2091249) 2091249..2091314 + 66 NuclAT_19 - -
- (2091249) 2091249..2091314 + 66 NuclAT_19 - -
- (2091249) 2091249..2091314 + 66 NuclAT_19 - -
- (2091249) 2091249..2091314 + 66 NuclAT_21 - -
- (2091249) 2091249..2091314 + 66 NuclAT_21 - -
- (2091249) 2091249..2091314 + 66 NuclAT_21 - -
- (2091249) 2091249..2091314 + 66 NuclAT_21 - -
- (2091249) 2091249..2091314 + 66 NuclAT_26 - -
- (2091249) 2091249..2091314 + 66 NuclAT_26 - -
- (2091249) 2091249..2091314 + 66 NuclAT_26 - -
- (2091249) 2091249..2091314 + 66 NuclAT_26 - -
- (2091249) 2091249..2091314 + 66 NuclAT_28 - -
- (2091249) 2091249..2091314 + 66 NuclAT_28 - -
- (2091249) 2091249..2091314 + 66 NuclAT_28 - -
- (2091249) 2091249..2091314 + 66 NuclAT_28 - -
- (2091249) 2091249..2091316 + 68 NuclAT_30 - -
- (2091249) 2091249..2091316 + 68 NuclAT_30 - -
- (2091249) 2091249..2091316 + 68 NuclAT_30 - -
- (2091249) 2091249..2091316 + 68 NuclAT_30 - -
- (2091249) 2091249..2091316 + 68 NuclAT_31 - -
- (2091249) 2091249..2091316 + 68 NuclAT_31 - -
- (2091249) 2091249..2091316 + 68 NuclAT_31 - -
- (2091249) 2091249..2091316 + 68 NuclAT_31 - -
- (2091249) 2091249..2091316 + 68 NuclAT_32 - -
- (2091249) 2091249..2091316 + 68 NuclAT_32 - -
- (2091249) 2091249..2091316 + 68 NuclAT_32 - -
- (2091249) 2091249..2091316 + 68 NuclAT_32 - -
- (2091249) 2091249..2091316 + 68 NuclAT_33 - -
- (2091249) 2091249..2091316 + 68 NuclAT_33 - -
- (2091249) 2091249..2091316 + 68 NuclAT_33 - -
- (2091249) 2091249..2091316 + 68 NuclAT_33 - -
- (2091249) 2091249..2091316 + 68 NuclAT_34 - -
- (2091249) 2091249..2091316 + 68 NuclAT_34 - -
- (2091249) 2091249..2091316 + 68 NuclAT_34 - -
- (2091249) 2091249..2091316 + 68 NuclAT_34 - -
- (2091249) 2091249..2091316 + 68 NuclAT_35 - -
- (2091249) 2091249..2091316 + 68 NuclAT_35 - -
- (2091249) 2091249..2091316 + 68 NuclAT_35 - -
- (2091249) 2091249..2091316 + 68 NuclAT_35 - -
AOY88_RS10285 (2091606) 2091606..2092706 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
AOY88_RS10290 (2092976) 2092976..2093206 + 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY88_RS10295 (2093364) 2093364..2094059 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY88_RS10300 (2094103) 2094103..2094456 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T103283 WP_000170954.1 NZ_CP028740:c2090666-2090559 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T103283 NZ_CP028740:c2090666-2090559 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT103283 NZ_CP028740:2090716-2090779 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References