Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2810140..2810360 | Replicon | chromosome |
| Accession | NZ_CP028738 | ||
| Organism | Escherichia coli strain A38 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | AOY91_RS13685 | Protein ID | WP_000170965.1 |
| Coordinates | 2810253..2810360 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2810140..2810206 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOY91_RS13660 | 2805419..2806813 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
| AOY91_RS13665 | 2806998..2807351 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| AOY91_RS13670 | 2807395..2808090 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AOY91_RS13675 | 2808248..2808478 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| AOY91_RS13680 | 2808748..2809848 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2810140..2810206 | - | 67 | - | - | Antitoxin |
| AOY91_RS13685 | 2810253..2810360 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2810673..2810736 | - | 64 | NuclAT_34 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_34 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_34 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_34 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_36 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_36 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_36 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_36 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_38 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_38 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_38 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_38 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_40 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_40 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_40 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_40 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_42 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_42 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_42 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_42 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_44 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_44 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_44 | - | - |
| - | 2810673..2810736 | - | 64 | NuclAT_44 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_46 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_46 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_46 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_46 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_49 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_49 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_49 | - | - |
| - | 2810674..2810736 | - | 63 | NuclAT_49 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_16 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_16 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_16 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_16 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_19 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_19 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_19 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_19 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_22 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_22 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_22 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_22 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_25 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_25 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_25 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_25 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_28 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_28 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_28 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_28 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_31 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_31 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_31 | - | - |
| - | 2810675..2810736 | - | 62 | NuclAT_31 | - | - |
| AOY91_RS13690 | 2810789..2810896 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2811210..2811276 | - | 67 | NuclAT_45 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_45 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_45 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_45 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_48 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_48 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_48 | - | - |
| - | 2811210..2811276 | - | 67 | NuclAT_48 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_17 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_17 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_17 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_17 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_20 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_20 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_20 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_20 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_23 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_23 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_23 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_23 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_26 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_26 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_26 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_26 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_29 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_29 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_29 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_29 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_32 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_32 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_32 | - | - |
| - | 2811211..2811274 | - | 64 | NuclAT_32 | - | - |
| AOY91_RS13695 | 2811324..2811431 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| AOY91_RS13700 | 2811580..2812434 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AOY91_RS13705 | 2812470..2813279 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| AOY91_RS13710 | 2813283..2813675 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| AOY91_RS13715 | 2813672..2814505 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T103246 WP_000170965.1 NZ_CP028738:2810253-2810360 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T103246 NZ_CP028738:2810253-2810360 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT103246 NZ_CP028738:c2810206-2810140 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|