Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2810140..2810360 Replicon chromosome
Accession NZ_CP028738
Organism Escherichia coli strain A38

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag AOY91_RS13685 Protein ID WP_000170965.1
Coordinates 2810253..2810360 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2810140..2810206 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AOY91_RS13660 2805419..2806813 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
AOY91_RS13665 2806998..2807351 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
AOY91_RS13670 2807395..2808090 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
AOY91_RS13675 2808248..2808478 - 231 WP_001146442.1 putative cation transport regulator ChaB -
AOY91_RS13680 2808748..2809848 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2810140..2810206 - 67 - - Antitoxin
AOY91_RS13685 2810253..2810360 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2810673..2810736 - 64 NuclAT_34 - -
- 2810673..2810736 - 64 NuclAT_34 - -
- 2810673..2810736 - 64 NuclAT_34 - -
- 2810673..2810736 - 64 NuclAT_34 - -
- 2810673..2810736 - 64 NuclAT_36 - -
- 2810673..2810736 - 64 NuclAT_36 - -
- 2810673..2810736 - 64 NuclAT_36 - -
- 2810673..2810736 - 64 NuclAT_36 - -
- 2810673..2810736 - 64 NuclAT_38 - -
- 2810673..2810736 - 64 NuclAT_38 - -
- 2810673..2810736 - 64 NuclAT_38 - -
- 2810673..2810736 - 64 NuclAT_38 - -
- 2810673..2810736 - 64 NuclAT_40 - -
- 2810673..2810736 - 64 NuclAT_40 - -
- 2810673..2810736 - 64 NuclAT_40 - -
- 2810673..2810736 - 64 NuclAT_40 - -
- 2810673..2810736 - 64 NuclAT_42 - -
- 2810673..2810736 - 64 NuclAT_42 - -
- 2810673..2810736 - 64 NuclAT_42 - -
- 2810673..2810736 - 64 NuclAT_42 - -
- 2810673..2810736 - 64 NuclAT_44 - -
- 2810673..2810736 - 64 NuclAT_44 - -
- 2810673..2810736 - 64 NuclAT_44 - -
- 2810673..2810736 - 64 NuclAT_44 - -
- 2810674..2810736 - 63 NuclAT_46 - -
- 2810674..2810736 - 63 NuclAT_46 - -
- 2810674..2810736 - 63 NuclAT_46 - -
- 2810674..2810736 - 63 NuclAT_46 - -
- 2810674..2810736 - 63 NuclAT_49 - -
- 2810674..2810736 - 63 NuclAT_49 - -
- 2810674..2810736 - 63 NuclAT_49 - -
- 2810674..2810736 - 63 NuclAT_49 - -
- 2810675..2810736 - 62 NuclAT_16 - -
- 2810675..2810736 - 62 NuclAT_16 - -
- 2810675..2810736 - 62 NuclAT_16 - -
- 2810675..2810736 - 62 NuclAT_16 - -
- 2810675..2810736 - 62 NuclAT_19 - -
- 2810675..2810736 - 62 NuclAT_19 - -
- 2810675..2810736 - 62 NuclAT_19 - -
- 2810675..2810736 - 62 NuclAT_19 - -
- 2810675..2810736 - 62 NuclAT_22 - -
- 2810675..2810736 - 62 NuclAT_22 - -
- 2810675..2810736 - 62 NuclAT_22 - -
- 2810675..2810736 - 62 NuclAT_22 - -
- 2810675..2810736 - 62 NuclAT_25 - -
- 2810675..2810736 - 62 NuclAT_25 - -
- 2810675..2810736 - 62 NuclAT_25 - -
- 2810675..2810736 - 62 NuclAT_25 - -
- 2810675..2810736 - 62 NuclAT_28 - -
- 2810675..2810736 - 62 NuclAT_28 - -
- 2810675..2810736 - 62 NuclAT_28 - -
- 2810675..2810736 - 62 NuclAT_28 - -
- 2810675..2810736 - 62 NuclAT_31 - -
- 2810675..2810736 - 62 NuclAT_31 - -
- 2810675..2810736 - 62 NuclAT_31 - -
- 2810675..2810736 - 62 NuclAT_31 - -
AOY91_RS13690 2810789..2810896 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2811210..2811276 - 67 NuclAT_45 - -
- 2811210..2811276 - 67 NuclAT_45 - -
- 2811210..2811276 - 67 NuclAT_45 - -
- 2811210..2811276 - 67 NuclAT_45 - -
- 2811210..2811276 - 67 NuclAT_48 - -
- 2811210..2811276 - 67 NuclAT_48 - -
- 2811210..2811276 - 67 NuclAT_48 - -
- 2811210..2811276 - 67 NuclAT_48 - -
- 2811211..2811274 - 64 NuclAT_17 - -
- 2811211..2811274 - 64 NuclAT_17 - -
- 2811211..2811274 - 64 NuclAT_17 - -
- 2811211..2811274 - 64 NuclAT_17 - -
- 2811211..2811274 - 64 NuclAT_20 - -
- 2811211..2811274 - 64 NuclAT_20 - -
- 2811211..2811274 - 64 NuclAT_20 - -
- 2811211..2811274 - 64 NuclAT_20 - -
- 2811211..2811274 - 64 NuclAT_23 - -
- 2811211..2811274 - 64 NuclAT_23 - -
- 2811211..2811274 - 64 NuclAT_23 - -
- 2811211..2811274 - 64 NuclAT_23 - -
- 2811211..2811274 - 64 NuclAT_26 - -
- 2811211..2811274 - 64 NuclAT_26 - -
- 2811211..2811274 - 64 NuclAT_26 - -
- 2811211..2811274 - 64 NuclAT_26 - -
- 2811211..2811274 - 64 NuclAT_29 - -
- 2811211..2811274 - 64 NuclAT_29 - -
- 2811211..2811274 - 64 NuclAT_29 - -
- 2811211..2811274 - 64 NuclAT_29 - -
- 2811211..2811274 - 64 NuclAT_32 - -
- 2811211..2811274 - 64 NuclAT_32 - -
- 2811211..2811274 - 64 NuclAT_32 - -
- 2811211..2811274 - 64 NuclAT_32 - -
AOY91_RS13695 2811324..2811431 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
AOY91_RS13700 2811580..2812434 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AOY91_RS13705 2812470..2813279 - 810 WP_001257044.1 invasion regulator SirB1 -
AOY91_RS13710 2813283..2813675 - 393 WP_000200378.1 invasion regulator SirB2 -
AOY91_RS13715 2813672..2814505 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T103246 WP_000170965.1 NZ_CP028738:2810253-2810360 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T103246 NZ_CP028738:2810253-2810360 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT103246 NZ_CP028738:c2810206-2810140 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References