Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 229870..230092 | Replicon | chromosome |
| Accession | NZ_CP028734 | ||
| Organism | Escherichia coli strain A42 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A3K0NFU8 |
| Locus tag | AOY95_RS01080 | Protein ID | WP_000170748.1 |
| Coordinates | 229985..230092 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 229870..229928 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AOY95_RS01060 | 225741..226724 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| AOY95_RS01065 | 226721..227725 | + | 1005 | WP_001525880.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| AOY95_RS01070 | 227755..229026 | - | 1272 | WP_001525879.1 | aromatic amino acid transport family protein | - |
| AOY95_RS01075 | 229502..229609 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 229870..229928 | - | 59 | - | - | Antitoxin |
| AOY95_RS01080 | 229985..230092 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| AOY95_RS01085 | 230468..230575 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| AOY95_RS01090 | 230661..232340 | - | 1680 | WP_022296260.1 | cellulose biosynthesis protein BcsG | - |
| AOY95_RS01095 | 232337..232528 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| AOY95_RS01100 | 232525..234096 | - | 1572 | WP_001204941.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| AOY95_RS01105 | 234369..234557 | + | 189 | WP_001525878.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3913.76 Da Isoelectric Point: 9.0157
>T103149 WP_000170748.1 NZ_CP028734:229985-230092 [Escherichia coli]
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
MTLAELGMAFWHDLAVPVITGILASMIVSWLNKRK
Download Length: 108 bp
>T103149 NZ_CP028734:229985-230092 [Escherichia coli]
ATGACGCTCGCAGAGTTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGTTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTACTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT103149 NZ_CP028734:c229928-229870 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|