Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 1739097..1739292 | Replicon | chromosome |
Accession | NZ_CP028724 | ||
Organism | Enterococcus faecalis strain CVM N60443F |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | C7I31_RS14340 | Protein ID | WP_015543884.1 |
Coordinates | 1739197..1739292 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 1739097..1739162 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7I31_RS08660 | 1734723..1736471 | + | 1749 | WP_161971855.1 | PTS transporter subunit EIIC | - |
C7I31_RS08665 | 1736462..1738495 | + | 2034 | WP_002355275.1 | transcription antiterminator | - |
C7I31_RS08670 | 1738506..1738940 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 1739097..1739162 | + | 66 | NuclAT_16 | - | Antitoxin |
C7I31_RS14340 | 1739197..1739292 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
C7I31_RS08680 | 1739538..1741310 | + | 1773 | WP_002405272.1 | PTS mannitol transporter subunit IICBA | - |
C7I31_RS08685 | 1741325..1741762 | + | 438 | WP_131639235.1 | PTS sugar transporter subunit IIA | - |
C7I31_RS08690 | 1741777..1742931 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
C7I31_RS08695 | 1743000..1744115 | - | 1116 | WP_131639236.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T103084 WP_015543884.1 NZ_CP028724:c1739292-1739197 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T103084 NZ_CP028724:c1739292-1739197 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCTATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCTATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT103084 NZ_CP028724:1739097-1739162 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|