Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 721609..721804 | Replicon | chromosome |
Accession | NZ_CP028720 | ||
Organism | Enterococcus faecalis strain CVM N48037F |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | C7I32_RS16125 | Protein ID | WP_122975133.1 |
Coordinates | 721609..721704 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 721739..721804 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7I32_RS03750 | 716788..717903 | + | 1116 | WP_033626490.1 | FAD-binding oxidoreductase | - |
C7I32_RS03755 | 717970..719124 | - | 1155 | WP_033626491.1 | mannitol-1-phosphate 5-dehydrogenase | - |
C7I32_RS03760 | 719139..719576 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
C7I32_RS03765 | 719591..721363 | - | 1773 | WP_033626492.1 | PTS mannitol transporter subunit IICBA | - |
C7I32_RS16125 | 721609..721704 | + | 96 | WP_122975133.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 721739..721804 | - | 66 | NuclAT_15 | - | Antitoxin |
C7I32_RS03775 | 721960..722394 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
C7I32_RS03780 | 722405..724438 | - | 2034 | WP_016626080.1 | transcription antiterminator | - |
C7I32_RS03785 | 724429..726177 | - | 1749 | WP_033626493.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3645.44 Da Isoelectric Point: 4.5869
>T103041 WP_122975133.1 NZ_CP028720:721609-721704 [Enterococcus faecalis]
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYDIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T103041 NZ_CP028720:721609-721704 [Enterococcus faecalis]
ATGTACGACATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGACATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT103041 NZ_CP028720:c721804-721739 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|