Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2128312..2128534 Replicon chromosome
Accession NZ_CP028703
Organism Escherichia coli strain ME8067

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag DBB47_RS11065 Protein ID WP_000170955.1
Coordinates 2128312..2128419 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2128467..2128534 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBB47_RS11030 2124168..2125001 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
DBB47_RS11035 2124998..2125390 + 393 WP_000200374.1 invasion regulator SirB2 -
DBB47_RS11040 2125394..2126203 + 810 WP_001257044.1 invasion regulator SirB1 -
DBB47_RS11045 2126239..2127093 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DBB47_RS11050 2127242..2127349 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2127397..2127463 + 67 NuclAT_34 - -
- 2127397..2127463 + 67 NuclAT_34 - -
- 2127397..2127463 + 67 NuclAT_34 - -
- 2127397..2127463 + 67 NuclAT_34 - -
- 2127397..2127463 + 67 NuclAT_36 - -
- 2127397..2127463 + 67 NuclAT_36 - -
- 2127397..2127463 + 67 NuclAT_36 - -
- 2127397..2127463 + 67 NuclAT_36 - -
- 2127397..2127463 + 67 NuclAT_38 - -
- 2127397..2127463 + 67 NuclAT_38 - -
- 2127397..2127463 + 67 NuclAT_38 - -
- 2127397..2127463 + 67 NuclAT_38 - -
- 2127397..2127463 + 67 NuclAT_40 - -
- 2127397..2127463 + 67 NuclAT_40 - -
- 2127397..2127463 + 67 NuclAT_40 - -
- 2127397..2127463 + 67 NuclAT_40 - -
- 2127397..2127463 + 67 NuclAT_42 - -
- 2127397..2127463 + 67 NuclAT_42 - -
- 2127397..2127463 + 67 NuclAT_42 - -
- 2127397..2127463 + 67 NuclAT_42 - -
- 2127397..2127463 + 67 NuclAT_44 - -
- 2127397..2127463 + 67 NuclAT_44 - -
- 2127397..2127463 + 67 NuclAT_44 - -
- 2127397..2127463 + 67 NuclAT_44 - -
- 2127399..2127464 + 66 NuclAT_18 - -
- 2127399..2127464 + 66 NuclAT_18 - -
- 2127399..2127464 + 66 NuclAT_18 - -
- 2127399..2127464 + 66 NuclAT_18 - -
- 2127399..2127464 + 66 NuclAT_21 - -
- 2127399..2127464 + 66 NuclAT_21 - -
- 2127399..2127464 + 66 NuclAT_21 - -
- 2127399..2127464 + 66 NuclAT_21 - -
- 2127399..2127464 + 66 NuclAT_24 - -
- 2127399..2127464 + 66 NuclAT_24 - -
- 2127399..2127464 + 66 NuclAT_24 - -
- 2127399..2127464 + 66 NuclAT_24 - -
- 2127399..2127464 + 66 NuclAT_27 - -
- 2127399..2127464 + 66 NuclAT_27 - -
- 2127399..2127464 + 66 NuclAT_27 - -
- 2127399..2127464 + 66 NuclAT_27 - -
- 2127399..2127464 + 66 NuclAT_30 - -
- 2127399..2127464 + 66 NuclAT_30 - -
- 2127399..2127464 + 66 NuclAT_30 - -
- 2127399..2127464 + 66 NuclAT_30 - -
- 2127399..2127464 + 66 NuclAT_33 - -
- 2127399..2127464 + 66 NuclAT_33 - -
- 2127399..2127464 + 66 NuclAT_33 - -
- 2127399..2127464 + 66 NuclAT_33 - -
DBB47_RS11055 2127777..2127884 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2127932..2127999 + 68 NuclAT_17 - -
- 2127932..2127999 + 68 NuclAT_17 - -
- 2127932..2127999 + 68 NuclAT_17 - -
- 2127932..2127999 + 68 NuclAT_17 - -
- 2127932..2127999 + 68 NuclAT_20 - -
- 2127932..2127999 + 68 NuclAT_20 - -
- 2127932..2127999 + 68 NuclAT_20 - -
- 2127932..2127999 + 68 NuclAT_20 - -
- 2127932..2127999 + 68 NuclAT_23 - -
- 2127932..2127999 + 68 NuclAT_23 - -
- 2127932..2127999 + 68 NuclAT_23 - -
- 2127932..2127999 + 68 NuclAT_23 - -
- 2127932..2127999 + 68 NuclAT_26 - -
- 2127932..2127999 + 68 NuclAT_26 - -
- 2127932..2127999 + 68 NuclAT_26 - -
- 2127932..2127999 + 68 NuclAT_26 - -
- 2127932..2127999 + 68 NuclAT_29 - -
- 2127932..2127999 + 68 NuclAT_29 - -
- 2127932..2127999 + 68 NuclAT_29 - -
- 2127932..2127999 + 68 NuclAT_29 - -
- 2127932..2127999 + 68 NuclAT_32 - -
- 2127932..2127999 + 68 NuclAT_32 - -
- 2127932..2127999 + 68 NuclAT_32 - -
- 2127932..2127999 + 68 NuclAT_32 - -
- 2127933..2127998 + 66 NuclAT_35 - -
- 2127933..2127998 + 66 NuclAT_35 - -
- 2127933..2127998 + 66 NuclAT_35 - -
- 2127933..2127998 + 66 NuclAT_35 - -
- 2127933..2127998 + 66 NuclAT_37 - -
- 2127933..2127998 + 66 NuclAT_37 - -
- 2127933..2127998 + 66 NuclAT_37 - -
- 2127933..2127998 + 66 NuclAT_37 - -
- 2127933..2127998 + 66 NuclAT_39 - -
- 2127933..2127998 + 66 NuclAT_39 - -
- 2127933..2127998 + 66 NuclAT_39 - -
- 2127933..2127998 + 66 NuclAT_39 - -
- 2127933..2127998 + 66 NuclAT_41 - -
- 2127933..2127998 + 66 NuclAT_41 - -
- 2127933..2127998 + 66 NuclAT_41 - -
- 2127933..2127998 + 66 NuclAT_41 - -
- 2127933..2127998 + 66 NuclAT_43 - -
- 2127933..2127998 + 66 NuclAT_43 - -
- 2127933..2127998 + 66 NuclAT_43 - -
- 2127933..2127998 + 66 NuclAT_43 - -
- 2127933..2127998 + 66 NuclAT_45 - -
- 2127933..2127998 + 66 NuclAT_45 - -
- 2127933..2127998 + 66 NuclAT_45 - -
- 2127933..2127998 + 66 NuclAT_45 - -
DBB47_RS11065 2128312..2128419 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 2128467..2128534 + 68 NuclAT_16 - Antitoxin
- 2128467..2128534 + 68 NuclAT_16 - Antitoxin
- 2128467..2128534 + 68 NuclAT_16 - Antitoxin
- 2128467..2128534 + 68 NuclAT_16 - Antitoxin
- 2128467..2128534 + 68 NuclAT_19 - Antitoxin
- 2128467..2128534 + 68 NuclAT_19 - Antitoxin
- 2128467..2128534 + 68 NuclAT_19 - Antitoxin
- 2128467..2128534 + 68 NuclAT_19 - Antitoxin
- 2128467..2128534 + 68 NuclAT_22 - Antitoxin
- 2128467..2128534 + 68 NuclAT_22 - Antitoxin
- 2128467..2128534 + 68 NuclAT_22 - Antitoxin
- 2128467..2128534 + 68 NuclAT_22 - Antitoxin
- 2128467..2128534 + 68 NuclAT_25 - Antitoxin
- 2128467..2128534 + 68 NuclAT_25 - Antitoxin
- 2128467..2128534 + 68 NuclAT_25 - Antitoxin
- 2128467..2128534 + 68 NuclAT_25 - Antitoxin
- 2128467..2128534 + 68 NuclAT_28 - Antitoxin
- 2128467..2128534 + 68 NuclAT_28 - Antitoxin
- 2128467..2128534 + 68 NuclAT_28 - Antitoxin
- 2128467..2128534 + 68 NuclAT_28 - Antitoxin
- 2128467..2128534 + 68 NuclAT_31 - Antitoxin
- 2128467..2128534 + 68 NuclAT_31 - Antitoxin
- 2128467..2128534 + 68 NuclAT_31 - Antitoxin
- 2128467..2128534 + 68 NuclAT_31 - Antitoxin
DBB47_RS11070 2128823..2129923 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
DBB47_RS11075 2130193..2130423 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DBB47_RS11080 2130581..2131276 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
DBB47_RS11085 2131320..2131673 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
DBB47_RS11090 2131858..2133252 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T102993 WP_000170955.1 NZ_CP028703:c2128419-2128312 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T102993 NZ_CP028703:c2128419-2128312 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT102993 NZ_CP028703:2128467-2128534 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References