Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1702892..1703114 Replicon chromosome
Accession NZ_CP028702
Organism Escherichia coli strain J53

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag DBB46_RS08945 Protein ID WP_000170963.1
Coordinates 1702892..1702999 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1703047..1703114 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DBB46_RS08915 1698201..1699283 + 1083 WP_000804726.1 peptide chain release factor 1 -
DBB46_RS08920 1699283..1700116 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
DBB46_RS08925 1700113..1700505 + 393 WP_000200374.1 invasion regulator SirB2 -
DBB46_RS08930 1700509..1701318 + 810 WP_001257044.1 invasion regulator SirB1 -
DBB46_RS08935 1701354..1702208 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DBB46_RS08940 1702357..1702464 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1702512..1702578 + 67 NuclAT_34 - -
- 1702512..1702578 + 67 NuclAT_34 - -
- 1702512..1702578 + 67 NuclAT_34 - -
- 1702512..1702578 + 67 NuclAT_34 - -
- 1702512..1702578 + 67 NuclAT_36 - -
- 1702512..1702578 + 67 NuclAT_36 - -
- 1702512..1702578 + 67 NuclAT_36 - -
- 1702512..1702578 + 67 NuclAT_36 - -
- 1702512..1702578 + 67 NuclAT_38 - -
- 1702512..1702578 + 67 NuclAT_38 - -
- 1702512..1702578 + 67 NuclAT_38 - -
- 1702512..1702578 + 67 NuclAT_38 - -
- 1702512..1702578 + 67 NuclAT_40 - -
- 1702512..1702578 + 67 NuclAT_40 - -
- 1702512..1702578 + 67 NuclAT_40 - -
- 1702512..1702578 + 67 NuclAT_40 - -
- 1702512..1702578 + 67 NuclAT_42 - -
- 1702512..1702578 + 67 NuclAT_42 - -
- 1702512..1702578 + 67 NuclAT_42 - -
- 1702512..1702578 + 67 NuclAT_42 - -
- 1702512..1702578 + 67 NuclAT_44 - -
- 1702512..1702578 + 67 NuclAT_44 - -
- 1702512..1702578 + 67 NuclAT_44 - -
- 1702512..1702578 + 67 NuclAT_44 - -
- 1702514..1702579 + 66 NuclAT_18 - -
- 1702514..1702579 + 66 NuclAT_18 - -
- 1702514..1702579 + 66 NuclAT_18 - -
- 1702514..1702579 + 66 NuclAT_18 - -
- 1702514..1702579 + 66 NuclAT_21 - -
- 1702514..1702579 + 66 NuclAT_21 - -
- 1702514..1702579 + 66 NuclAT_21 - -
- 1702514..1702579 + 66 NuclAT_21 - -
- 1702514..1702579 + 66 NuclAT_24 - -
- 1702514..1702579 + 66 NuclAT_24 - -
- 1702514..1702579 + 66 NuclAT_24 - -
- 1702514..1702579 + 66 NuclAT_24 - -
- 1702514..1702579 + 66 NuclAT_27 - -
- 1702514..1702579 + 66 NuclAT_27 - -
- 1702514..1702579 + 66 NuclAT_27 - -
- 1702514..1702579 + 66 NuclAT_27 - -
- 1702514..1702579 + 66 NuclAT_30 - -
- 1702514..1702579 + 66 NuclAT_30 - -
- 1702514..1702579 + 66 NuclAT_30 - -
- 1702514..1702579 + 66 NuclAT_30 - -
- 1702514..1702579 + 66 NuclAT_33 - -
- 1702514..1702579 + 66 NuclAT_33 - -
- 1702514..1702579 + 66 NuclAT_33 - -
- 1702514..1702579 + 66 NuclAT_33 - -
DBB46_RS08945 1702892..1702999 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1703047..1703114 + 68 NuclAT_17 - Antitoxin
- 1703047..1703114 + 68 NuclAT_17 - Antitoxin
- 1703047..1703114 + 68 NuclAT_17 - Antitoxin
- 1703047..1703114 + 68 NuclAT_17 - Antitoxin
- 1703047..1703114 + 68 NuclAT_20 - Antitoxin
- 1703047..1703114 + 68 NuclAT_20 - Antitoxin
- 1703047..1703114 + 68 NuclAT_20 - Antitoxin
- 1703047..1703114 + 68 NuclAT_20 - Antitoxin
- 1703047..1703114 + 68 NuclAT_23 - Antitoxin
- 1703047..1703114 + 68 NuclAT_23 - Antitoxin
- 1703047..1703114 + 68 NuclAT_23 - Antitoxin
- 1703047..1703114 + 68 NuclAT_23 - Antitoxin
- 1703047..1703114 + 68 NuclAT_26 - Antitoxin
- 1703047..1703114 + 68 NuclAT_26 - Antitoxin
- 1703047..1703114 + 68 NuclAT_26 - Antitoxin
- 1703047..1703114 + 68 NuclAT_26 - Antitoxin
- 1703047..1703114 + 68 NuclAT_29 - Antitoxin
- 1703047..1703114 + 68 NuclAT_29 - Antitoxin
- 1703047..1703114 + 68 NuclAT_29 - Antitoxin
- 1703047..1703114 + 68 NuclAT_29 - Antitoxin
- 1703047..1703114 + 68 NuclAT_32 - Antitoxin
- 1703047..1703114 + 68 NuclAT_32 - Antitoxin
- 1703047..1703114 + 68 NuclAT_32 - Antitoxin
- 1703047..1703114 + 68 NuclAT_32 - Antitoxin
- 1703048..1703113 + 66 NuclAT_35 - -
- 1703048..1703113 + 66 NuclAT_35 - -
- 1703048..1703113 + 66 NuclAT_35 - -
- 1703048..1703113 + 66 NuclAT_35 - -
- 1703048..1703113 + 66 NuclAT_37 - -
- 1703048..1703113 + 66 NuclAT_37 - -
- 1703048..1703113 + 66 NuclAT_37 - -
- 1703048..1703113 + 66 NuclAT_37 - -
- 1703048..1703113 + 66 NuclAT_39 - -
- 1703048..1703113 + 66 NuclAT_39 - -
- 1703048..1703113 + 66 NuclAT_39 - -
- 1703048..1703113 + 66 NuclAT_39 - -
- 1703048..1703113 + 66 NuclAT_41 - -
- 1703048..1703113 + 66 NuclAT_41 - -
- 1703048..1703113 + 66 NuclAT_41 - -
- 1703048..1703113 + 66 NuclAT_41 - -
- 1703048..1703113 + 66 NuclAT_43 - -
- 1703048..1703113 + 66 NuclAT_43 - -
- 1703048..1703113 + 66 NuclAT_43 - -
- 1703048..1703113 + 66 NuclAT_43 - -
- 1703048..1703113 + 66 NuclAT_45 - -
- 1703048..1703113 + 66 NuclAT_45 - -
- 1703048..1703113 + 66 NuclAT_45 - -
- 1703048..1703113 + 66 NuclAT_45 - -
DBB46_RS08955 1703427..1703534 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1703582..1703649 + 68 NuclAT_16 - -
- 1703582..1703649 + 68 NuclAT_16 - -
- 1703582..1703649 + 68 NuclAT_16 - -
- 1703582..1703649 + 68 NuclAT_16 - -
- 1703582..1703649 + 68 NuclAT_19 - -
- 1703582..1703649 + 68 NuclAT_19 - -
- 1703582..1703649 + 68 NuclAT_19 - -
- 1703582..1703649 + 68 NuclAT_19 - -
- 1703582..1703649 + 68 NuclAT_22 - -
- 1703582..1703649 + 68 NuclAT_22 - -
- 1703582..1703649 + 68 NuclAT_22 - -
- 1703582..1703649 + 68 NuclAT_22 - -
- 1703582..1703649 + 68 NuclAT_25 - -
- 1703582..1703649 + 68 NuclAT_25 - -
- 1703582..1703649 + 68 NuclAT_25 - -
- 1703582..1703649 + 68 NuclAT_25 - -
- 1703582..1703649 + 68 NuclAT_28 - -
- 1703582..1703649 + 68 NuclAT_28 - -
- 1703582..1703649 + 68 NuclAT_28 - -
- 1703582..1703649 + 68 NuclAT_28 - -
- 1703582..1703649 + 68 NuclAT_31 - -
- 1703582..1703649 + 68 NuclAT_31 - -
- 1703582..1703649 + 68 NuclAT_31 - -
- 1703582..1703649 + 68 NuclAT_31 - -
DBB46_RS08960 1703938..1705038 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
DBB46_RS08965 1705308..1705538 + 231 WP_001146444.1 putative cation transport regulator ChaB -
DBB46_RS08970 1705696..1706391 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
DBB46_RS08975 1706435..1706788 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T102946 WP_000170963.1 NZ_CP028702:c1702999-1702892 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T102946 NZ_CP028702:c1702999-1702892 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT102946 NZ_CP028702:1703047-1703114 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References