Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2585209..2585434 | Replicon | chromosome |
Accession | NZ_CP028680 | ||
Organism | Escherichia coli strain 113 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E42_RS13370 | Protein ID | WP_000813258.1 |
Coordinates | 2585279..2585434 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2585209..2585267 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E42_RS13320 | 2580274..2580516 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E42_RS13325 | 2580500..2580925 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E42_RS13330 | 2580994..2582037 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E42_RS13335 | 2582030..2582491 | + | 462 | WP_000139447.1 | replication protein | - |
C9E42_RS13340 | 2582525..2583241 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E42_RS13345 | 2583274..2583555 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E42_RS13350 | 2583552..2583779 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E42_RS13355 | 2583772..2584083 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E42_RS13360 | 2584211..2584429 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E42_RS13365 | 2584431..2584988 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2585209..2585267 | - | 59 | - | - | Antitoxin |
C9E42_RS13370 | 2585279..2585434 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E42_RS13375 | 2585554..2585898 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E42_RS13380 | 2586020..2586292 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E42_RS13385 | 2586294..2587343 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E42_RS13390 | 2587356..2587661 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E42_RS13395 | 2587724..2588278 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E42_RS13400 | 2588503..2588700 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E42_RS13405 | 2588836..2589549 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E42_RS13420 | 2590000..2590431 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 | 2506935..2629447 | 122512 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102658 WP_000813258.1 NZ_CP028680:2585279-2585434 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102658 NZ_CP028680:2585279-2585434 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102658 NZ_CP028680:c2585267-2585209 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|