Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3462747..3462972 | Replicon | chromosome |
| Accession | NZ_CP028677 | ||
| Organism | Escherichia coli strain 114 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | C9E43_RS18185 | Protein ID | WP_000813263.1 |
| Coordinates | 3462747..3462902 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3462914..3462972 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E43_RS18150 | 3458201..3458914 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| C9E43_RS18155 | 3459052..3459248 | - | 197 | Protein_3452 | TrmB family transcriptional regulator | - |
| C9E43_RS18160 | 3459535..3460353 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| C9E43_RS18165 | 3460505..3460876 | - | 372 | WP_000090264.1 | antitermination protein | - |
| C9E43_RS18170 | 3460866..3461237 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E43_RS18175 | 3461250..3462299 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| C9E43_RS18180 | 3462301..3462579 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| C9E43_RS18185 | 3462747..3462902 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3462914..3462972 | + | 59 | - | - | Antitoxin |
| C9E43_RS18200 | 3463507..3464280 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| C9E43_RS18205 | 3464632..3465045 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| C9E43_RS18210 | 3465061..3465831 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| C9E43_RS18215 | 3465853..3466599 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| C9E43_RS18220 | 3466606..3467697 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T102626 WP_000813263.1 NZ_CP028677:c3462902-3462747 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T102626 NZ_CP028677:c3462902-3462747 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT102626 NZ_CP028677:3462914-3462972 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|