Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2527882..2528107 | Replicon | chromosome |
| Accession | NZ_CP028674 | ||
| Organism | Escherichia coli strain 115 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | C9E44_RS12915 | Protein ID | WP_000813258.1 |
| Coordinates | 2527952..2528107 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2527882..2527940 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E44_RS12865 | 2522947..2523189 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| C9E44_RS12870 | 2523173..2523598 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| C9E44_RS12875 | 2523667..2524710 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| C9E44_RS12880 | 2524703..2525164 | + | 462 | WP_000139447.1 | replication protein | - |
| C9E44_RS12885 | 2525198..2525914 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| C9E44_RS12890 | 2525947..2526228 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| C9E44_RS12895 | 2526225..2526452 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| C9E44_RS12900 | 2526445..2526756 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| C9E44_RS12905 | 2526884..2527102 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| C9E44_RS12910 | 2527104..2527661 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2527882..2527940 | - | 59 | - | - | Antitoxin |
| C9E44_RS12915 | 2527952..2528107 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C9E44_RS12920 | 2528227..2528571 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| C9E44_RS12925 | 2528693..2528965 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| C9E44_RS12930 | 2528967..2530016 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| C9E44_RS12935 | 2530029..2530334 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E44_RS12940 | 2530397..2530951 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| C9E44_RS12945 | 2531176..2531373 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| C9E44_RS12950 | 2531509..2532222 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| C9E44_RS12965 | 2532673..2533104 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI / espM1 | 2449609..2565221 | 115612 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102586 WP_000813258.1 NZ_CP028674:2527952-2528107 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102586 NZ_CP028674:2527952-2528107 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102586 NZ_CP028674:c2527940-2527882 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|