Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2586739..2586964 | Replicon | chromosome |
Accession | NZ_CP028668 | ||
Organism | Escherichia coli strain 117 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E46_RS13385 | Protein ID | WP_000813258.1 |
Coordinates | 2586809..2586964 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2586739..2586797 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E46_RS13335 | 2581804..2582046 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E46_RS13340 | 2582030..2582455 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E46_RS13345 | 2582524..2583567 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E46_RS13350 | 2583560..2584021 | + | 462 | WP_000139447.1 | replication protein | - |
C9E46_RS13355 | 2584055..2584771 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E46_RS13360 | 2584804..2585085 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E46_RS13365 | 2585082..2585309 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E46_RS13370 | 2585302..2585613 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E46_RS13375 | 2585741..2585959 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E46_RS13380 | 2585961..2586518 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2586739..2586797 | - | 59 | - | - | Antitoxin |
C9E46_RS13385 | 2586809..2586964 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E46_RS13390 | 2587084..2587428 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E46_RS13395 | 2587550..2587822 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E46_RS13400 | 2587824..2588873 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E46_RS13405 | 2588886..2589191 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E46_RS13410 | 2589254..2589808 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E46_RS13415 | 2590033..2590230 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E46_RS13420 | 2590366..2591079 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E46_RS13435 | 2591530..2591961 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 | 2507154..2624078 | 116924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102514 WP_000813258.1 NZ_CP028668:2586809-2586964 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102514 NZ_CP028668:2586809-2586964 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102514 NZ_CP028668:c2586797-2586739 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|