Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3462742..3462967 | Replicon | chromosome |
Accession | NZ_CP028662 | ||
Organism | Escherichia coli strain 119 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | C9E48_RS18185 | Protein ID | WP_000813263.1 |
Coordinates | 3462742..3462897 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3462909..3462967 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E48_RS18150 | 3458196..3458909 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
C9E48_RS18155 | 3459047..3459243 | - | 197 | Protein_3452 | TrmB family transcriptional regulator | - |
C9E48_RS18160 | 3459530..3460348 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
C9E48_RS18165 | 3460500..3460871 | - | 372 | WP_000090264.1 | antitermination protein | - |
C9E48_RS18170 | 3460861..3461232 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E48_RS18175 | 3461245..3462294 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
C9E48_RS18180 | 3462296..3462574 | - | 279 | WP_001341388.1 | hypothetical protein | - |
C9E48_RS18185 | 3462742..3462897 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3462909..3462967 | + | 59 | - | - | Antitoxin |
C9E48_RS18205 | 3463502..3464275 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
C9E48_RS18210 | 3464627..3465040 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
C9E48_RS18215 | 3465056..3465826 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
C9E48_RS18220 | 3465848..3466594 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
C9E48_RS18225 | 3466601..3467692 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T102446 WP_000813263.1 NZ_CP028662:c3462897-3462742 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T102446 NZ_CP028662:c3462897-3462742 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT102446 NZ_CP028662:3462909-3462967 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|