Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2585276..2585501 | Replicon | chromosome |
Accession | NZ_CP028662 | ||
Organism | Escherichia coli strain 119 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E48_RS13370 | Protein ID | WP_000813258.1 |
Coordinates | 2585346..2585501 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2585276..2585334 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E48_RS13320 | 2580341..2580583 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E48_RS13325 | 2580567..2580992 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E48_RS13330 | 2581061..2582104 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E48_RS13335 | 2582097..2582558 | + | 462 | WP_000139447.1 | replication protein | - |
C9E48_RS13340 | 2582592..2583308 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E48_RS13345 | 2583341..2583622 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E48_RS13350 | 2583619..2583846 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E48_RS13355 | 2583839..2584150 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E48_RS13360 | 2584278..2584496 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E48_RS13365 | 2584498..2585055 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2585276..2585334 | - | 59 | - | - | Antitoxin |
C9E48_RS13370 | 2585346..2585501 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E48_RS13375 | 2585621..2585965 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E48_RS13380 | 2586087..2586359 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E48_RS13385 | 2586361..2587410 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E48_RS13390 | 2587423..2587728 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E48_RS13395 | 2587791..2588345 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E48_RS13400 | 2588570..2588767 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E48_RS13405 | 2588903..2589616 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E48_RS13420 | 2590067..2590498 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 | 2507003..2629514 | 122511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102442 WP_000813258.1 NZ_CP028662:2585346-2585501 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102442 NZ_CP028662:2585346-2585501 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102442 NZ_CP028662:c2585334-2585276 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|