Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2586738..2586963 | Replicon | chromosome |
Accession | NZ_CP028656 | ||
Organism | Escherichia coli strain 121 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E50_RS13385 | Protein ID | WP_000813258.1 |
Coordinates | 2586808..2586963 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2586738..2586796 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E50_RS13335 | 2581803..2582045 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E50_RS13340 | 2582029..2582454 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E50_RS13345 | 2582523..2583566 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E50_RS13350 | 2583559..2584020 | + | 462 | WP_000139447.1 | replication protein | - |
C9E50_RS13355 | 2584054..2584770 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E50_RS13360 | 2584803..2585084 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E50_RS13365 | 2585081..2585308 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E50_RS13370 | 2585301..2585612 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E50_RS13375 | 2585740..2585958 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E50_RS13380 | 2585960..2586517 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2586738..2586796 | - | 59 | - | - | Antitoxin |
C9E50_RS13385 | 2586808..2586963 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E50_RS13390 | 2587083..2587427 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E50_RS13395 | 2587549..2587821 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E50_RS13400 | 2587823..2588872 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E50_RS13405 | 2588885..2589190 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E50_RS13410 | 2589253..2589807 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E50_RS13415 | 2590032..2590229 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E50_RS13420 | 2590365..2591078 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E50_RS13435 | 2591529..2591960 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 | 2507153..2624077 | 116924 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102370 WP_000813258.1 NZ_CP028656:2586808-2586963 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102370 NZ_CP028656:2586808-2586963 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102370 NZ_CP028656:c2586796-2586738 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|