Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | AapB-IsoB/- |
| Location | 865516..865671 | Replicon | chromosome |
| Accession | NC_000915 | ||
| Organism | Helicobacter pylori 26695 | ||
| T1TAdb ID | TA03829 | ||
Toxin (Protein)
| Gene name | AapB | Uniprot ID | - |
| Locus tag | - | Protein ID | - |
| Coordinates | 865516..865644 (-) | Length | 43 a.a. |
Antitoxin (RNA)
| Gene name | IsoB | ||
| Locus tag | - | ||
| Coordinates | 865570..865671 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HP_RS03930 (HP0807) | 860980..863357 | - | 2378 | Protein_768 | TonB-dependent receptor family protein | - |
| HP_RS03930 (HP0807) | 860980..863357 | - | 2378 | Protein_768 | TonB-dependent receptor family protein | - |
| HP_RS03930 (HP0807) | 860980..863357 | - | 2378 | Protein_768 | TonB-dependent receptor family protein | - |
| HP_RS03930 (HP0807) | 860980..863357 | - | 2378 | Protein_768 | TonB-dependent receptor family protein | - |
| HP_RS03935 (HP0808) | 863551..863910 | - | 360 | WP_000579175.1 | holo-ACP synthase | - |
| HP_RS03935 (HP0808) | 863551..863910 | - | 360 | WP_000579175.1 | holo-ACP synthase | - |
| HP_RS03935 (HP0808) | 863551..863910 | - | 360 | WP_000579175.1 | holo-ACP synthase | - |
| HP_RS03935 (HP0808) | 863551..863910 | - | 360 | WP_000579175.1 | holo-ACP synthase | - |
| HP_RS03940 (HP0809) | 863917..864468 | - | 552 | WP_000797017.1 | flagellar basal body-associated protein FliL | - |
| HP_RS03940 (HP0809) | 863917..864468 | - | 552 | WP_000797017.1 | flagellar basal body-associated protein FliL | - |
| HP_RS03940 (HP0809) | 863917..864468 | - | 552 | WP_000797017.1 | flagellar basal body-associated protein FliL | - |
| HP_RS03940 (HP0809) | 863917..864468 | - | 552 | WP_000797017.1 | flagellar basal body-associated protein FliL | - |
| HP_RS03945 (HP0810) | 864477..865079 | - | 603 | WP_001132760.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| HP_RS03945 (HP0810) | 864477..865079 | - | 603 | WP_001132760.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| HP_RS03945 (HP0810) | 864477..865079 | - | 603 | WP_001132760.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| HP_RS03945 (HP0810) | 864477..865079 | - | 603 | WP_001132760.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| HP_RS03950 (HP0811) | 865058..865384 | - | 327 | WP_000688953.1 | hypothetical protein | - |
| HP_RS03950 (HP0811) | 865058..865384 | - | 327 | WP_000688953.1 | hypothetical protein | - |
| HP_RS03950 (HP0811) | 865058..865384 | - | 327 | WP_000688953.1 | hypothetical protein | - |
| HP_RS03950 (HP0811) | 865058..865384 | - | 327 | WP_000688953.1 | hypothetical protein | - |
| HP_RS03955 (HP0812) | 865837..866847 | - | 1011 | WP_001256047.1 | class I SAM-dependent methyltransferase | - |
| HP_RS03955 (HP0812) | 865837..866847 | - | 1011 | WP_001256047.1 | class I SAM-dependent methyltransferase | - |
| HP_RS03955 (HP0812) | 865837..866847 | - | 1011 | WP_001256047.1 | class I SAM-dependent methyltransferase | - |
| HP_RS03955 (HP0812) | 865837..866847 | - | 1011 | WP_001256047.1 | class I SAM-dependent methyltransferase | - |
| HP_RS03960 (HP0813) | 866980..867597 | + | 618 | WP_000404680.1 | MBL fold metallo-hydrolase | - |
| HP_RS03960 (HP0813) | 866980..867597 | + | 618 | WP_000404680.1 | MBL fold metallo-hydrolase | - |
| HP_RS03960 (HP0813) | 866980..867597 | + | 618 | WP_000404680.1 | MBL fold metallo-hydrolase | - |
| HP_RS03960 (HP0813) | 866980..867597 | + | 618 | WP_000404680.1 | MBL fold metallo-hydrolase | - |
| HP_RS03965 (HP0814) | 867598..868365 | + | 768 | WP_000952609.1 | HesA/MoeB/ThiF family protein | - |
| HP_RS03965 (HP0814) | 867598..868365 | + | 768 | WP_000952609.1 | HesA/MoeB/ThiF family protein | - |
| HP_RS03965 (HP0814) | 867598..868365 | + | 768 | WP_000952609.1 | HesA/MoeB/ThiF family protein | - |
| HP_RS03965 (HP0814) | 867598..868365 | + | 768 | WP_000952609.1 | HesA/MoeB/ThiF family protein | - |
| HP_RS03970 (HP0815) | 868381..869154 | + | 774 | WP_000366185.1 | flagellar motor stator protein MotA | - |
| HP_RS03970 (HP0815) | 868381..869154 | + | 774 | WP_000366185.1 | flagellar motor stator protein MotA | - |
| HP_RS03970 (HP0815) | 868381..869154 | + | 774 | WP_000366185.1 | flagellar motor stator protein MotA | - |
| HP_RS03970 (HP0815) | 868381..869154 | + | 774 | WP_000366185.1 | flagellar motor stator protein MotA | - |
| HP_RS03975 (HP0816) | 869157..869930 | + | 774 | WP_001085308.1 | flagellar motor protein MotB | - |
| HP_RS03975 (HP0816) | 869157..869930 | + | 774 | WP_001085308.1 | flagellar motor protein MotB | - |
| HP_RS03975 (HP0816) | 869157..869930 | + | 774 | WP_001085308.1 | flagellar motor protein MotB | - |
| HP_RS03975 (HP0816) | 869157..869930 | + | 774 | WP_001085308.1 | flagellar motor protein MotB | - |
| HP_RS03980 (HP0817) | 869936..870373 | + | 438 | WP_001875392.1 | hypothetical protein | - |
| HP_RS03980 (HP0817) | 869936..870373 | + | 438 | WP_001875392.1 | hypothetical protein | - |
| HP_RS03980 (HP0817) | 869936..870373 | + | 438 | WP_001875392.1 | hypothetical protein | - |
| HP_RS03980 (HP0817) | 869936..870373 | + | 438 | WP_001875392.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 43 a.a. Molecular weight: 5084.35 Da Isoelectric Point: 11.2662
>T10217 - NC_000915:c865644-865516 [Helicobacter pylori 26695]
MKKLIKMLSYSKERRNIIRLSLLPSPSIIPKKKKTMLFELYF
MKKLIKMLSYSKERRNIIRLSLLPSPSIIPKKKKTMLFELYF
Download Length: 129 bp
>T10217 NC_000915:c865644-865516 [Helicobacter pylori 26695]
ATGAAAAAGTTGATTAAAATGCTAAGTTATAGTAAAGAAAGAAGGAATATAATACGCCTTTCGCTCTTACCTTCGCCGAG
CATTATACCAAAAAAAAAAAAAACGATGTTATTTGAACTTTATTTTTAA
ATGAAAAAGTTGATTAAAATGCTAAGTTATAGTAAAGAAAGAAGGAATATAATACGCCTTTCGCTCTTACCTTCGCCGAG
CATTATACCAAAAAAAAAAAAAACGATGTTATTTGAACTTTATTTTTAA
Antitoxin
Download Length: 102 bp
>AT10217 NC_000915:865570-865671 [Helicobacter pylori 26695]
CGAAGGTAAGAGCGAAAGGCGTATTATATTCCTTCTTTCTTTACTATAACTTAGCATTTTAATCAACTTTTTCATTAAAA
TGTCCTGACGCTCTTACCTTAA
CGAAGGTAAGAGCGAAAGGCGTATTATATTCCTTCTTTCTTTACTATAACTTAGCATTTTAATCAACTTTTTCATTAAAA
TGTCCTGACGCTCTTACCTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
(1) Cynthia M Sharma et al. (2010) The primary transcriptome of the major human pathogen Helicobacter pylori. Nature 464(7286):250-5. [PubMed:20164839]