Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2585289..2585514 | Replicon | chromosome |
| Accession | NZ_CP028632 | ||
| Organism | Escherichia coli strain 135 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | C9E59_RS13370 | Protein ID | WP_000813258.1 |
| Coordinates | 2585359..2585514 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2585289..2585347 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E59_RS13320 | 2580354..2580596 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| C9E59_RS13325 | 2580580..2581005 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| C9E59_RS13330 | 2581074..2582117 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| C9E59_RS13335 | 2582110..2582571 | + | 462 | WP_000139447.1 | replication protein | - |
| C9E59_RS13340 | 2582605..2583321 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| C9E59_RS13345 | 2583354..2583635 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| C9E59_RS13350 | 2583632..2583859 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| C9E59_RS13355 | 2583852..2584163 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| C9E59_RS13360 | 2584291..2584509 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| C9E59_RS13365 | 2584511..2585068 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2585289..2585347 | - | 59 | - | - | Antitoxin |
| C9E59_RS13370 | 2585359..2585514 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C9E59_RS13375 | 2585634..2585978 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| C9E59_RS13380 | 2586100..2586372 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| C9E59_RS13385 | 2586374..2587423 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| C9E59_RS13390 | 2587436..2587741 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E59_RS13395 | 2587804..2588358 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| C9E59_RS13400 | 2588583..2588780 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| C9E59_RS13405 | 2588916..2589629 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| C9E59_RS13420 | 2590080..2590511 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI / espM1 | 2513609..2629527 | 115918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T102057 WP_000813258.1 NZ_CP028632:2585359-2585514 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T102057 NZ_CP028632:2585359-2585514 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT102057 NZ_CP028632:c2585347-2585289 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|