Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2585282..2585507 | Replicon | chromosome |
| Accession | NZ_CP028620 | ||
| Organism | Escherichia coli strain 139 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | C9E63_RS13370 | Protein ID | WP_000813258.1 |
| Coordinates | 2585352..2585507 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2585282..2585340 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E63_RS13320 | 2580347..2580589 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| C9E63_RS13325 | 2580573..2580998 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| C9E63_RS13330 | 2581067..2582110 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| C9E63_RS13335 | 2582103..2582564 | + | 462 | WP_000139447.1 | replication protein | - |
| C9E63_RS13340 | 2582598..2583314 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| C9E63_RS13345 | 2583347..2583628 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| C9E63_RS13350 | 2583625..2583852 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| C9E63_RS13355 | 2583845..2584156 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| C9E63_RS13360 | 2584284..2584502 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
| C9E63_RS13365 | 2584504..2585061 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2585282..2585340 | - | 59 | - | - | Antitoxin |
| C9E63_RS13370 | 2585352..2585507 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C9E63_RS13375 | 2585627..2585971 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| C9E63_RS13380 | 2586093..2586365 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| C9E63_RS13385 | 2586367..2587416 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| C9E63_RS13390 | 2587429..2587734 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E63_RS13395 | 2587797..2588351 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| C9E63_RS13400 | 2588576..2588773 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| C9E63_RS13405 | 2588909..2589622 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| C9E63_RS13420 | 2590073..2590504 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI / espM1 | 2507010..2629520 | 122510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101914 WP_000813258.1 NZ_CP028620:2585352-2585507 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101914 NZ_CP028620:2585352-2585507 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101914 NZ_CP028620:c2585340-2585282 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|