Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2586374..2586599 | Replicon | chromosome |
Accession | NZ_CP028614 | ||
Organism | Escherichia coli strain 141 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E65_RS13380 | Protein ID | WP_000813258.1 |
Coordinates | 2586444..2586599 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2586374..2586432 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E65_RS13330 | 2581439..2581681 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E65_RS13335 | 2581665..2582090 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E65_RS13340 | 2582159..2583202 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E65_RS13345 | 2583195..2583656 | + | 462 | WP_000139447.1 | replication protein | - |
C9E65_RS13350 | 2583690..2584406 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E65_RS13355 | 2584439..2584720 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E65_RS13360 | 2584717..2584944 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E65_RS13365 | 2584937..2585248 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E65_RS13370 | 2585376..2585594 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E65_RS13375 | 2585596..2586153 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2586374..2586432 | - | 59 | - | - | Antitoxin |
C9E65_RS13380 | 2586444..2586599 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E65_RS13385 | 2586719..2587063 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E65_RS13390 | 2587185..2587457 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E65_RS13395 | 2587459..2588508 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E65_RS13400 | 2588521..2588826 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E65_RS13405 | 2588889..2589443 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E65_RS13410 | 2589668..2589865 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E65_RS13415 | 2590001..2590714 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E65_RS13430 | 2591165..2591596 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 | 2513381..2623713 | 110332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101842 WP_000813258.1 NZ_CP028614:2586444-2586599 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101842 NZ_CP028614:2586444-2586599 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101842 NZ_CP028614:c2586432-2586374 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|