Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2678380..2678605 | Replicon | chromosome |
Accession | NZ_CP028603 | ||
Organism | Escherichia coli strain 144 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E68_RS13950 | Protein ID | WP_000813258.1 |
Coordinates | 2678450..2678605 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2678380..2678438 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E68_RS13900 | 2673445..2673687 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E68_RS13905 | 2673671..2674096 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E68_RS13910 | 2674165..2675208 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E68_RS13915 | 2675201..2675662 | + | 462 | WP_000139447.1 | replication protein | - |
C9E68_RS13920 | 2675696..2676412 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E68_RS13925 | 2676445..2676726 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E68_RS13930 | 2676723..2676950 | + | 228 | WP_000699809.1 | hypothetical protein | - |
C9E68_RS13935 | 2676943..2677254 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E68_RS13940 | 2677382..2677600 | + | 219 | WP_137049466.1 | DUF4014 family protein | - |
C9E68_RS13945 | 2677602..2678159 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2678380..2678438 | - | 59 | - | - | Antitoxin |
C9E68_RS13950 | 2678450..2678605 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E68_RS13955 | 2678725..2679069 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E68_RS13960 | 2679191..2679463 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E68_RS13965 | 2679465..2680514 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E68_RS13970 | 2680527..2680832 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E68_RS13975 | 2680895..2681449 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E68_RS13980 | 2681674..2681871 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E68_RS13985 | 2682008..2682721 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E68_RS14000 | 2683176..2683604 | + | 429 | WP_001303509.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 / nleG7' | 2551493..2715721 | 164228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101737 WP_000813258.1 NZ_CP028603:2678450-2678605 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101737 NZ_CP028603:2678450-2678605 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101737 NZ_CP028603:c2678438-2678380 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|