Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2628988..2629213 | Replicon | chromosome |
Accession | NZ_CP028603 | ||
Organism | Escherichia coli strain 144 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C9E68_RS13615 | Protein ID | WP_000813254.1 |
Coordinates | 2629058..2629213 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2628988..2629046 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E68_RS13570 | 2624241..2625194 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
C9E68_RS13575 | 2625201..2625941 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
C9E68_RS13580 | 2625971..2626741 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
C9E68_RS13585 | 2626757..2627152 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
C9E68_RS13590 | 2627209..2627565 | + | 357 | WP_001302146.1 | hypothetical protein | - |
C9E68_RS13595 | 2627614..2627826 | + | 213 | WP_000063625.1 | hypothetical protein | - |
C9E68_RS13600 | 2627862..2628233 | + | 372 | WP_000137941.1 | hypothetical protein | - |
C9E68_RS13605 | 2628230..2628592 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
C9E68_RS13610 | 2628708..2628812 | + | 105 | WP_001278450.1 | hypothetical protein | - |
- | 2628988..2629046 | - | 59 | - | - | Antitoxin |
C9E68_RS13615 | 2629058..2629213 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
C9E68_RS28975 | 2629510..2629677 | + | 168 | WP_000998188.1 | hypothetical protein | - |
C9E68_RS13620 | 2629743..2630021 | + | 279 | WP_001304183.1 | hypothetical protein | - |
C9E68_RS13625 | 2630023..2631072 | + | 1050 | Protein_2604 | DUF968 domain-containing protein | - |
C9E68_RS13630 | 2631085..2631459 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E68_RS13635 | 2631456..2632277 | + | 822 | WP_000762904.1 | antitermination protein | - |
C9E68_RS13640 | 2632504..2632701 | + | 198 | WP_000917735.1 | hypothetical protein | - |
C9E68_RS13645 | 2632852..2633910 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleA/espI / espM1 / nleG7' | 2551493..2715721 | 164228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T101735 WP_000813254.1 NZ_CP028603:2629058-2629213 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T101735 NZ_CP028603:2629058-2629213 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT101735 NZ_CP028603:c2629046-2628988 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|