Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2613571..2613796 | Replicon | chromosome |
Accession | NZ_CP028596 | ||
Organism | Escherichia coli strain 149 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | C9E71_RS13565 | Protein ID | WP_000813258.1 |
Coordinates | 2613641..2613796 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2613571..2613629 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9E71_RS13515 | 2608636..2608878 | + | 243 | WP_000747948.1 | hypothetical protein | - |
C9E71_RS13520 | 2608862..2609287 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
C9E71_RS13525 | 2609356..2610399 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
C9E71_RS13530 | 2610392..2610853 | + | 462 | WP_000139447.1 | replication protein | - |
C9E71_RS13535 | 2610887..2611603 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
C9E71_RS13540 | 2611636..2611917 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
C9E71_RS13545 | 2611914..2612141 | + | 228 | WP_000699808.1 | hypothetical protein | - |
C9E71_RS13550 | 2612134..2612445 | + | 312 | WP_001289673.1 | hypothetical protein | - |
C9E71_RS13555 | 2612573..2612791 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
C9E71_RS13560 | 2612793..2613350 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2613571..2613629 | - | 59 | - | - | Antitoxin |
C9E71_RS13565 | 2613641..2613796 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C9E71_RS13570 | 2613916..2614260 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
C9E71_RS13575 | 2614382..2614654 | + | 273 | WP_000191872.1 | hypothetical protein | - |
C9E71_RS13580 | 2614656..2615705 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
C9E71_RS13585 | 2615718..2616023 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
C9E71_RS13590 | 2616086..2616640 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
C9E71_RS13595 | 2616865..2617062 | + | 198 | WP_000917763.1 | hypothetical protein | - |
C9E71_RS13600 | 2617198..2617911 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
C9E71_RS13615 | 2618362..2618793 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' | 2551778..2644247 | 92469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101630 WP_000813258.1 NZ_CP028596:2613641-2613796 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101630 NZ_CP028596:2613641-2613796 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101630 NZ_CP028596:c2613629-2613571 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|