Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3608396..3608621 | Replicon | chromosome |
| Accession | NZ_CP028592 | ||
| Organism | Escherichia coli strain 150 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | C9E72_RS19200 | Protein ID | WP_000813263.1 |
| Coordinates | 3608396..3608551 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 3608563..3608621 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E72_RS19165 | 3603850..3604563 | - | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
| C9E72_RS19170 | 3604701..3604897 | - | 197 | Protein_3645 | TrmB family transcriptional regulator | - |
| C9E72_RS19175 | 3605184..3606002 | - | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| C9E72_RS19180 | 3606154..3606525 | - | 372 | WP_000090264.1 | antitermination protein | - |
| C9E72_RS19185 | 3606515..3606886 | - | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E72_RS19190 | 3606899..3607948 | - | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| C9E72_RS19195 | 3607950..3608228 | - | 279 | WP_001341388.1 | hypothetical protein | - |
| C9E72_RS19200 | 3608396..3608551 | - | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 3608563..3608621 | + | 59 | - | - | Antitoxin |
| C9E72_RS19220 | 3609156..3609929 | + | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| C9E72_RS19225 | 3610281..3610694 | - | 414 | WP_001151233.1 | DUF977 family protein | - |
| C9E72_RS19230 | 3610710..3611480 | - | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| C9E72_RS19235 | 3611502..3612248 | - | 747 | WP_000788751.1 | ATP-binding protein | - |
| C9E72_RS19240 | 3612255..3613346 | - | 1092 | WP_001205823.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T101596 WP_000813263.1 NZ_CP028592:c3608551-3608396 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T101596 NZ_CP028592:c3608551-3608396 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT101596 NZ_CP028592:3608563-3608621 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|