Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2697291..2697516 | Replicon | chromosome |
| Accession | NZ_CP028592 | ||
| Organism | Escherichia coli strain 150 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | C9E72_RS14120 | Protein ID | WP_000813258.1 |
| Coordinates | 2697361..2697516 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2697291..2697349 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E72_RS14070 | 2692356..2692598 | + | 243 | WP_000747948.1 | hypothetical protein | - |
| C9E72_RS14075 | 2692582..2693007 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| C9E72_RS14080 | 2693076..2694119 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
| C9E72_RS14085 | 2694112..2694573 | + | 462 | WP_000139447.1 | replication protein | - |
| C9E72_RS14090 | 2694607..2695323 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| C9E72_RS14095 | 2695356..2695637 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
| C9E72_RS14100 | 2695634..2695861 | + | 228 | WP_000699809.1 | hypothetical protein | - |
| C9E72_RS14105 | 2695854..2696165 | + | 312 | WP_001289673.1 | hypothetical protein | - |
| C9E72_RS14110 | 2696293..2696511 | + | 219 | WP_137049466.1 | DUF4014 family protein | - |
| C9E72_RS14115 | 2696513..2697070 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| - | 2697291..2697349 | - | 59 | - | - | Antitoxin |
| C9E72_RS14120 | 2697361..2697516 | + | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C9E72_RS14125 | 2697636..2697980 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| C9E72_RS14130 | 2698102..2698374 | + | 273 | WP_000191872.1 | hypothetical protein | - |
| C9E72_RS14135 | 2698376..2699425 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| C9E72_RS14140 | 2699438..2699743 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E72_RS14145 | 2699806..2700360 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
| C9E72_RS14150 | 2700585..2700782 | + | 198 | WP_000917763.1 | hypothetical protein | - |
| C9E72_RS14155 | 2700919..2701632 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| C9E72_RS14170 | 2702087..2702515 | + | 429 | WP_001303509.1 | tellurite resistance protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI / espM1 / nleG7' | 2571722..2734632 | 162910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T101592 WP_000813258.1 NZ_CP028592:2697361-2697516 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T101592 NZ_CP028592:2697361-2697516 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT101592 NZ_CP028592:c2697349-2697291 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|