Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2649216..2649441 | Replicon | chromosome |
| Accession | NZ_CP028592 | ||
| Organism | Escherichia coli strain 150 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | C9E72_RS13805 | Protein ID | WP_000813254.1 |
| Coordinates | 2649286..2649441 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2649216..2649274 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9E72_RS13760 | 2644469..2645422 | + | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
| C9E72_RS13765 | 2645429..2646169 | + | 741 | WP_000790456.1 | ATP-binding protein | - |
| C9E72_RS13770 | 2646199..2646969 | + | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
| C9E72_RS13775 | 2646985..2647380 | + | 396 | WP_001118161.1 | DUF977 family protein | - |
| C9E72_RS13780 | 2647437..2647793 | + | 357 | WP_001302146.1 | hypothetical protein | - |
| C9E72_RS13785 | 2647842..2648054 | + | 213 | WP_000063625.1 | hypothetical protein | - |
| C9E72_RS13790 | 2648090..2648461 | + | 372 | WP_000137941.1 | hypothetical protein | - |
| C9E72_RS13795 | 2648458..2648820 | + | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
| C9E72_RS13800 | 2648936..2649040 | + | 105 | WP_001278450.1 | hypothetical protein | - |
| - | 2649216..2649274 | - | 59 | - | - | Antitoxin |
| C9E72_RS13805 | 2649286..2649441 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| C9E72_RS29435 | 2649738..2649905 | + | 168 | WP_000998188.1 | hypothetical protein | - |
| C9E72_RS13810 | 2649971..2650249 | + | 279 | WP_001304183.1 | hypothetical protein | - |
| C9E72_RS13815 | 2650251..2651300 | + | 1050 | Protein_2635 | DUF968 domain-containing protein | - |
| C9E72_RS13820 | 2651313..2651687 | + | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9E72_RS13825 | 2651684..2652505 | + | 822 | WP_000762904.1 | antitermination protein | - |
| C9E72_RS13830 | 2652732..2652929 | + | 198 | WP_000917735.1 | hypothetical protein | - |
| C9E72_RS13835 | 2653080..2654138 | + | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleA/espI / espM1 / nleG7' | 2571722..2734632 | 162910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T101590 WP_000813254.1 NZ_CP028592:2649286-2649441 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T101590 NZ_CP028592:2649286-2649441 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT101590 NZ_CP028592:c2649274-2649216 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|