Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 72695..72948 | Replicon | plasmid pKPC2_020143 |
| Accession | NZ_CP028547 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain SCKP020143 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | CLQ46_RS02170 | Protein ID | WP_001312851.1 |
| Coordinates | 72799..72948 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 72695..72754 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CLQ46_RS02125 | 68355..68420 | - | 66 | Protein_92 | hypothetical protein | - |
| CLQ46_RS02130 | 68473..69177 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CLQ46_RS02135 | 69241..69402 | + | 162 | Protein_94 | DNA helicase | - |
| CLQ46_RS02140 | 69422..70168 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| CLQ46_RS02145 | 70223..70783 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| CLQ46_RS02150 | 70915..71115 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| CLQ46_RS02155 | 71501..72100 | + | 600 | WP_032083981.1 | hypothetical protein | - |
| CLQ46_RS02160 | 72264..72494 | + | 231 | WP_001736714.1 | hypothetical protein | - |
| CLQ46_RS02165 | 72517..72744 | - | 228 | Protein_100 | hypothetical protein | - |
| - | 72695..72754 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 72695..72754 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 72695..72754 | - | 60 | NuclAT_0 | - | Antitoxin |
| - | 72695..72754 | - | 60 | NuclAT_0 | - | Antitoxin |
| CLQ46_RS02170 | 72799..72948 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CLQ46_RS02175 | 73232..73480 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| CLQ46_RS02180 | 73481..73690 | - | 210 | WP_064765370.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 / catA2 | - | 1..73791 | 73791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T101407 WP_001312851.1 NZ_CP028547:72799-72948 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T101407 NZ_CP028547:72799-72948 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT101407 NZ_CP028547:c72754-72695 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|